Advanced Search (OLGA)

Gene: Fermt1 (FERM domain containing kindlin 1) Rattus norvegicus

Analyze

Symbol:

Fermt1

Name:

FERM domain containing kindlin 1

RGD ID:

1306816

Description:

Predicted to enable actin filament binding activity and integrin binding activity. Predicted to be involved in several processes, including positive regulation of cell adhesion; regulation of gene expression; and regulation of signal transduction. Predicted to be located in cell junction; cell periphery; and cytosol. Predicted to be active in focal adhesion. Human ortholog(s) of this gene implicated in Kindler syndrome; telangiectasis; and vesiculobullous skin disease. Orthologous to human FERMT1 (FERM domain containing kindlin 1); PARTICIPATES IN integrin mediated signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

fermitin family homolog 1; fermitin family homolog 1 (Drosophila); fermitin family member 1; hypothetical protein LOC296179; kindlin 1; LOC296179; RGD1306816; similar to chromosome 20 open reading frame 42; UNC-112 related protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FERMT1 (FERM domain containing kindlin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fermt1 (fermitin family member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fermt1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FERMT1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FERMT1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fermt1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FERMT1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FERMT1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fermt1 (FERM domain containing kindlin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FERMT3 (FERM domain containing kindlin 3)	HGNC	OrthoDB
Homo sapiens (human):	REEP5 (receptor accessory protein 5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FERMT1 (FERM domain containing kindlin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fermt1 (fermitin family member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fermt1 (fermitin family member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fit1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fit2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-112	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fermt1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	140,624,434 - 140,666,419 (-)	NCBI		GRCr8
mRatBN7.2	3	120,171,301 - 120,213,555 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	120,171,561 - 120,213,555 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	124,066,663 - 124,106,362 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	132,670,283 - 132,712,190 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	130,322,805 - 130,362,509 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	125,566,744 - 125,607,864 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	125,566,643 - 125,607,735 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	132,049,511 - 132,090,550 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	120,699,769 - 120,744,016 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	120,607,515 - 120,645,912 (-)	NCBI
Celera	3	118,957,538 - 118,999,128 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	Atrophy		ISO	RGD:1315645	1600405	Kindler syndrome, OMIM:173650	RGD
Fermt1	Rat	Erythema		ISO	RGD:1315645	1600405	Kindler syndrome, OMIM:173650	RGD
Fermt1	Rat	telangiectasis		ISO	RGD:1315645	1600405	Kindler syndrome, OMIM:173650	RGD
Fermt1	Rat	vesiculobullous skin disease		ISO	RGD:1315645	1600405	Kindler syndrome, OMIM:173650	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	genetic disease		ISO	RGD:1315645	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:28492532
Fermt1	Rat	Huntington's disease-like 1		ISO	RGD:1315645	8554872	ClinVar Annotator: match by term: Huntington disease-like 1	ClinVar	PMID:28492532
Fermt1	Rat	Inosine Triphosphatase Deficiency		ISO	RGD:1315645	8554872	ClinVar Annotator: match by term: Inosine triphosphatase deficiency	ClinVar	PMID:26224535\|PMID:28492532\|PMID:34989426
Fermt1	Rat	Kindler syndrome		ISO	RGD:1315645	8554872	ClinVar Annotator: match by term: FERMT1-related condition \| ClinVar Annotator: match by term: Kindler syndrome	ClinVar	PMID:12668616\|PMID:12789646\|PMID:14507403\|PMID:14962093\|PMID:15313809\|PMID:16199547\|PMID:16675959\|PMID:16702500\|PMID:17178989\|PMID:17460733\|PMID:17916195\|PMID:18528435\|PMID:19292718\|PMID:19762715\|PMID:20938162\|PMID:21336475\|PMID:21936020\|PMID:22220914\|PMID:22466645\|PMID:24346923\|PMID:24635075\|PMID:24635080\|PMID:25156791\|PMID:25437880\|PMID:25599393\|PMID:25741868\|PMID:26937547\|PMID:27293055\|PMID:27862150\|PMID:28443301\|PMID:28492532\|PMID:29130490\|PMID:29453417\|PMID:30838128\|PMID:31340837\|PMID:31957900
Fermt1	Rat	pantothenate kinase-associated neurodegeneration		ISO	RGD:1315645	8554872	ClinVar Annotator: match by term: Pigmentary pallidal degeneration	ClinVar	PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	Kindler syndrome		ISO	RGD:1315645	11554173	CTD Direct Evidence: marker/mechanism	CTD

Imported Disease Annotations - MGI

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	Kindler syndrome		ISS	RGD:1315646	13592920	OMIM:173650	MouseDO

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	Kindler syndrome		ISO	RGD:1315645	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1315646	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FERMT1 mRNA	CTD	PMID:36331819
Fermt1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1315646	6480464	1,2-Dimethylhydrazine results in increased expression of FERMT1 mRNA	CTD	PMID:22206623
Fermt1	Rat	1,3-dinitrobenzene	decreases expression	EXP		6480464	3-dinitrobenzene results in decreased expression of FERMT1 protein	CTD	PMID:24140754
Fermt1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of FERMT1 mRNA	CTD	PMID:30723492
Fermt1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1315645	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of FERMT1 mRNA; [Estradiol co-treated with TGFB1 more ...	CTD	PMID:17404688\|PMID:20660070\|PMID:30165855
Fermt1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1315646	6480464	Tetrachlorodibenzodioxin results in decreased expression of FERMT1 mRNA	CTD	PMID:21354282
Fermt1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	increases expression	ISO	RGD:1315645	6480464	2,2',4,4',5-brominated diphenyl ether results in increased expression of FERMT1 mRNA	CTD	PMID:26705709
Fermt1	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:1315645	6480464	[Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ...	CTD	PMID:38598786
Fermt1	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:1315645	6480464	Lactic Acid results in decreased expression of FERMT1 mRNA	CTD	PMID:30851411
Fermt1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1315645	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Fermt1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1315646	6480464	bisphenol S results in increased expression of FERMT1 mRNA	CTD	PMID:30951980\|PMID:39298647
Fermt1	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:1315645	6480464	Decitabine affects the expression of FERMT1 mRNA	CTD	PMID:23300844
Fermt1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of FERMT1 mRNA	CTD	PMID:24780913
Fermt1	Rat	acrolein	multiple interactions	ISO	RGD:1315645	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ...	CTD	PMID:32699268\|PMID:32845096
Fermt1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of FERMT1 mRNA	CTD	PMID:28959563
Fermt1	Rat	aflatoxin B1	increases methylation	ISO	RGD:1315645	6480464	Aflatoxin B1 results in increased methylation of FERMT1 intron	CTD	PMID:30157460
Fermt1	Rat	Aflatoxin B2 alpha	increases methylation	ISO	RGD:1315645	6480464	aflatoxin B2 results in increased methylation of FERMT1 intron	CTD	PMID:30157460
Fermt1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1315645	6480464	Tretinoin results in increased expression of FERMT1 mRNA	CTD	PMID:21934132
Fermt1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1315645	6480464	Tretinoin results in decreased expression of FERMT1 mRNA	CTD	PMID:33167477
Fermt1	Rat	alpha-pinene	multiple interactions	ISO	RGD:1315645	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ...	CTD	PMID:32699268
Fermt1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FERMT1 mRNA	CTD	PMID:35163327
Fermt1	Rat	aristolochic acid A	decreases expression	ISO	RGD:1315645	6480464	aristolochic acid I results in decreased expression of FERMT1 mRNA	CTD	PMID:33212167
Fermt1	Rat	arsane	multiple interactions	ISO	RGD:1315645	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Fermt1	Rat	arsenic atom	multiple interactions	ISO	RGD:1315645	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Fermt1	Rat	arsenous acid	decreases response to substance	ISO	RGD:1315645	6480464	FERMT1 protein results in decreased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Fermt1	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of FERMT1 mRNA	CTD	PMID:36841081
Fermt1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1315645	6480464	Benzo(a)pyrene results in increased expression of FERMT1 mRNA	CTD	PMID:22316170
Fermt1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1315645	6480464	Benzo(a)pyrene results in decreased methylation of FERMT1 5' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
Fermt1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1315645	6480464	Benzo(a)pyrene affects the methylation of FERMT1 intron; Benzo(a)pyrene affects the methylation of FERMT1 promoter	CTD	PMID:30157460
Fermt1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1315645	6480464	Benzo(a)pyrene results in decreased expression of FERMT1 mRNA	CTD	PMID:21714911
Fermt1	Rat	benzo[e]pyrene	increases methylation	ISO	RGD:1315645	6480464	benzo(e)pyrene results in increased methylation of FERMT1 intron	CTD	PMID:30157460
Fermt1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1315645	6480464	Diethylhexyl Phthalate results in increased expression of FERMT1 mRNA	CTD	PMID:31163220
Fermt1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FERMT1 mRNA	CTD	PMID:25181051
Fermt1	Rat	bisphenol A	increases expression	ISO	RGD:1315646	6480464	bisphenol A results in increased expression of FERMT1 mRNA	CTD	PMID:32156529
Fermt1	Rat	bisphenol A	increases expression	ISO	RGD:1315645	6480464	bisphenol A results in increased expression of FERMT1 mRNA	CTD	PMID:27685785
Fermt1	Rat	bisphenol F	multiple interactions	ISO	RGD:1315645	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Fermt1	Rat	bisphenol F	increases expression	ISO	RGD:1315646	6480464	bisphenol F results in increased expression of FERMT1 mRNA	CTD	PMID:30951980
Fermt1	Rat	butanal	increases expression	ISO	RGD:1315645	6480464	butyraldehyde results in increased expression of FERMT1 mRNA	CTD	PMID:26079696
Fermt1	Rat	cadmium dichloride	increases expression	ISO	RGD:1315645	6480464	Cadmium Chloride results in increased expression of FERMT1 mRNA	CTD	PMID:38568856
Fermt1	Rat	caffeine	affects phosphorylation	ISO	RGD:1315645	6480464	Caffeine affects the phosphorylation of FERMT1 protein	CTD	PMID:35688186
Fermt1	Rat	chloropicrin	decreases expression	ISO	RGD:1315645	6480464	chloropicrin results in decreased expression of FERMT1 mRNA	CTD	PMID:26352163
Fermt1	Rat	cisplatin	affects expression	ISO	RGD:1315645	6480464	Cisplatin affects the expression of FERMT1 mRNA	CTD	PMID:23300844
Fermt1	Rat	cisplatin	increases expression	ISO	RGD:1315645	6480464	Cisplatin results in increased expression of FERMT1 mRNA	CTD	PMID:27392435
Fermt1	Rat	cisplatin	multiple interactions	ISO	RGD:1315645	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of FERMT1 mRNA	CTD	PMID:27392435
Fermt1	Rat	cobalt dichloride	decreases expression	ISO	RGD:1315645	6480464	cobaltous chloride results in decreased expression of FERMT1 mRNA	CTD	PMID:19376846
Fermt1	Rat	copper(II) chloride	increases expression	ISO	RGD:1315645	6480464	cupric chloride results in increased expression of FERMT1 mRNA	CTD	PMID:38568856
Fermt1	Rat	copper(II) sulfate	increases expression	ISO	RGD:1315645	6480464	Copper Sulfate results in increased expression of FERMT1 mRNA	CTD	PMID:19549813
Fermt1	Rat	DDE	increases expression	ISO	RGD:1315645	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of FERMT1 mRNA	CTD	PMID:38568856
Fermt1	Rat	dexamethasone	multiple interactions	ISO	RGD:1315645	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Fermt1	Rat	diarsenic trioxide	decreases response to substance	ISO	RGD:1315645	6480464	FERMT1 protein results in decreased susceptibility to Arsenic Trioxide	CTD	PMID:20707922
Fermt1	Rat	diclofenac	increases expression	EXP		6480464	Diclofenac results in increased expression of FERMT1 mRNA	CTD	PMID:30723492
Fermt1	Rat	dicrotophos	increases expression	ISO	RGD:1315645	6480464	dicrotophos results in increased expression of FERMT1 mRNA	CTD	PMID:28302478
Fermt1	Rat	dioxygen	decreases expression	ISO	RGD:1315645	6480464	Oxygen deficiency results in decreased expression of FERMT1 mRNA	CTD	PMID:26516004
Fermt1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fermt1	Rat	doxorubicin	increases expression	ISO	RGD:1315645	6480464	Doxorubicin results in increased expression of FERMT1 mRNA	CTD	PMID:29803840
Fermt1	Rat	elemental selenium	decreases expression	ISO	RGD:1315645	6480464	Selenium results in decreased expression of FERMT1 mRNA	CTD	PMID:19244175
Fermt1	Rat	entinostat	increases expression	ISO	RGD:1315645	6480464	entinostat results in increased expression of FERMT1 mRNA	CTD	PMID:26272509
Fermt1	Rat	entinostat	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fermt1	Rat	fonofos	increases methylation	ISO	RGD:1315645	6480464	Fonofos results in increased methylation of FERMT1 promoter	CTD	PMID:22847954
Fermt1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of FERMT1 mRNA	CTD	PMID:27387713
Fermt1	Rat	furfural	multiple interactions	ISO	RGD:1315645	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Fermt1	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of FERMT1 mRNA	CTD	PMID:24395379
Fermt1	Rat	indometacin	multiple interactions	ISO	RGD:1315645	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Fermt1	Rat	lead diacetate	decreases expression	EXP		6480464	lead acetate results in decreased expression of FERMT1 mRNA	CTD	PMID:22641619
Fermt1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1315645	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FERMT1 mRNA	CTD	PMID:35811015
Fermt1	Rat	lipopolysaccharide	increases expression	ISO	RGD:1315645	6480464	Lipopolysaccharides results in increased expression of FERMT1 mRNA	CTD	PMID:35811015
Fermt1	Rat	manganese atom	multiple interactions	ISO	RGD:1315645	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Fermt1	Rat	manganese(0)	multiple interactions	ISO	RGD:1315645	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Fermt1	Rat	manganese(II) chloride	multiple interactions	ISO	RGD:1315645	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Fermt1	Rat	menadione	affects expression	ISO	RGD:1315645	6480464	Vitamin K 3 affects the expression of FERMT1 mRNA	CTD	PMID:20044591
Fermt1	Rat	methapyrilene	increases methylation	ISO	RGD:1315645	6480464	Methapyrilene results in increased methylation of FERMT1 intron	CTD	PMID:30157460
Fermt1	Rat	methylmercury chloride	increases expression	ISO	RGD:1315645	6480464	methylmercuric chloride results in increased expression of FERMT1 mRNA	CTD	PMID:28001369
Fermt1	Rat	microcystin-LR	multiple interactions	EXP		6480464	[Dietary Fats co-treated with Cholesterol, Dietary co-treated with cyanoginosin LR] results in increased expression of more ...	CTD	PMID:34740672
Fermt1	Rat	microcystin-LR	increases expression	EXP		6480464	cyanoginosin LR results in increased expression of FERMT1 mRNA	CTD	PMID:34740672
Fermt1	Rat	ozone	multiple interactions	ISO	RGD:1315645	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ...	CTD	PMID:32699268\|PMID:32845096
Fermt1	Rat	panobinostat	increases expression	ISO	RGD:1315645	6480464	panobinostat results in increased expression of FERMT1 mRNA	CTD	PMID:26272509
Fermt1	Rat	panobinostat	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fermt1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of FERMT1 mRNA	CTD	PMID:33387578
Fermt1	Rat	parathion	increases methylation	ISO	RGD:1315645	6480464	Parathion results in increased methylation of FERMT1 promoter	CTD	PMID:22847954
Fermt1	Rat	pentanal	increases expression	ISO	RGD:1315645	6480464	pentanal results in increased expression of FERMT1 mRNA	CTD	PMID:26079696
Fermt1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1315646	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of FERMT1 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Fermt1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of FERMT1 mRNA	CTD	PMID:35163327
Fermt1	Rat	phenylmercury acetate	increases expression	ISO	RGD:1315645	6480464	Phenylmercuric Acetate results in increased expression of FERMT1 mRNA	CTD	PMID:26272509
Fermt1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Fermt1	Rat	potassium chromate	increases expression	ISO	RGD:1315645	6480464	potassium chromate(VI) results in increased expression of FERMT1 mRNA	CTD	PMID:22714537
Fermt1	Rat	potassium dichromate	increases expression	ISO	RGD:1315646	6480464	Potassium Dichromate results in increased expression of FERMT1 mRNA	CTD	PMID:23608068
Fermt1	Rat	progesterone	decreases expression	ISO	RGD:1315645	6480464	Progesterone results in decreased expression of FERMT1 mRNA	CTD	PMID:17404688
Fermt1	Rat	progesterone	multiple interactions	ISO	RGD:1315645	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of FERMT1 mRNA; [Progesterone co-treated with Estradiol] more ...	CTD	PMID:17404688\|PMID:20660070
Fermt1	Rat	Ptaquiloside	decreases expression	ISO	RGD:1315646	6480464	ptaquiloside results in decreased expression of FERMT1 mRNA	CTD	PMID:23274088
Fermt1	Rat	quercetin	decreases expression	ISO	RGD:1315645	6480464	Quercetin results in decreased expression of FERMT1 mRNA	CTD	PMID:21632981
Fermt1	Rat	rac-lactic acid	decreases expression	ISO	RGD:1315645	6480464	Lactic Acid results in decreased expression of FERMT1 mRNA	CTD	PMID:30851411
Fermt1	Rat	Rutecarpine	decreases expression	ISO	RGD:1315645	6480464	rutecarpine results in decreased expression of FERMT1 mRNA	CTD	PMID:34955744
Fermt1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1315645	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FERMT1 mRNA	CTD	PMID:35811015
Fermt1	Rat	SB 431542	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fermt1	Rat	selenium atom	decreases expression	ISO	RGD:1315645	6480464	Selenium results in decreased expression of FERMT1 mRNA	CTD	PMID:19244175
Fermt1	Rat	silicon dioxide	increases expression	ISO	RGD:1315645	6480464	Silicon Dioxide analog results in increased expression of FERMT1 mRNA	CTD	PMID:25895662
Fermt1	Rat	silicon dioxide	decreases expression	ISO	RGD:1315645	6480464	Silicon Dioxide results in decreased expression of FERMT1 mRNA	CTD	PMID:25351596
Fermt1	Rat	sodium arsenite	decreases expression	ISO	RGD:1315645	6480464	sodium arsenite results in decreased expression of FERMT1 mRNA	CTD	PMID:38568856
Fermt1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1315645	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
Fermt1	Rat	sodium chloride	multiple interactions	ISO	RGD:1315645	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Fermt1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of FERMT1 mRNA	CTD	PMID:30047161
Fermt1	Rat	sunitinib	decreases expression	ISO	RGD:1315645	6480464	Sunitinib results in decreased expression of FERMT1 mRNA	CTD	PMID:31533062
Fermt1	Rat	temozolomide	increases expression	ISO	RGD:1315645	6480464	Temozolomide results in increased expression of FERMT1 mRNA	CTD	PMID:31758290
Fermt1	Rat	terbufos	increases methylation	ISO	RGD:1315645	6480464	terbufos results in increased methylation of FERMT1 promoter	CTD	PMID:22847954
Fermt1	Rat	testosterone	increases expression	ISO	RGD:1315646	6480464	Testosterone deficiency results in increased expression of FERMT1 mRNA	CTD	PMID:33848595
Fermt1	Rat	tributylstannane	increases expression	ISO	RGD:1315646	6480464	tributyltin results in increased expression of FERMT1 mRNA	CTD	PMID:31939706
Fermt1	Rat	trichostatin A	increases expression	ISO	RGD:1315645	6480464	trichostatin A results in increased expression of FERMT1 mRNA	CTD	PMID:24935251\|PMID:26272509
Fermt1	Rat	trichostatin A	affects expression	ISO	RGD:1315645	6480464	trichostatin A affects the expression of FERMT1 mRNA	CTD	PMID:28542535
Fermt1	Rat	trichostatin A	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Fermt1	Rat	urethane	decreases expression	ISO	RGD:1315645	6480464	Urethane results in decreased expression of FERMT1 mRNA	CTD	PMID:28818685
Fermt1	Rat	valproic acid	increases expression	ISO	RGD:1315645	6480464	Valproic Acid results in increased expression of FERMT1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509
Fermt1	Rat	valproic acid	multiple interactions	ISO	RGD:1315645	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Fermt1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of FERMT1 mRNA	CTD	PMID:23034163
Fermt1	Rat	vitamin E	decreases expression	ISO	RGD:1315645	6480464	Vitamin E results in decreased expression of FERMT1 mRNA	CTD	PMID:19244175

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	basement membrane organization	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	basement membrane organization	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	biological_process		ND		1598407	03/2007: No relevant rat data	RGD
Fermt1	Rat	cell adhesion	involved_in	ISO	RGD:1315645	1624291	UniProtKB:Q96AC1 PMID:17012746, PMID:21356350	RGD	PMID:17012746\|PMID:21356350
Fermt1	Rat	cell adhesion	involved_in	IEA	UniProtKB-KW:KW-0130	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fermt1	Rat	cell adhesion	involved_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	cell-matrix adhesion	involved_in	IBA	MGI:2385001\|PANTHER:PTN001043969\|UniProtKB:Q96AC1\|WB:WBGene00006836	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fermt1	Rat	establishment of epithelial cell polarity	involved_in	ISO	RGD:1315645	1624291	PMID:17012746	RGD	PMID:17012746
Fermt1	Rat	establishment of epithelial cell polarity	involved_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	integrin-mediated signaling pathway	involved_in	IEA	InterPro:IPR037837\|InterPro:IPR037843	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fermt1	Rat	keratinocyte migration	involved_in	ISO	RGD:1315645	1624291	PMID:17012746	RGD	PMID:17012746
Fermt1	Rat	keratinocyte migration	involved_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	keratinocyte proliferation	involved_in	ISO	RGD:1315645	1624291	PMID:17012746	RGD	PMID:17012746
Fermt1	Rat	keratinocyte proliferation	involved_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	negative regulation of gene expression	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	negative regulation of gene expression	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	negative regulation of protein import into nucleus	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	negative regulation of protein import into nucleus	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	negative regulation of stem cell proliferation	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	negative regulation of stem cell proliferation	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	negative regulation of timing of anagen	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	negative regulation of timing of anagen	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	positive regulation of cell adhesion mediated by integrin	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	positive regulation of cell adhesion mediated by integrin	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	positive regulation of cell-matrix adhesion	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	positive regulation of cell-matrix adhesion	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	positive regulation of integrin activation	involved_in	ISO	RGD:1315645	1624291	UniProtKB:Q96AC1 PMID:21356350	RGD	PMID:21356350
Fermt1	Rat	positive regulation of integrin activation	involved_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	positive regulation of transforming growth factor beta production	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	positive regulation of transforming growth factor beta production	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	positive regulation of transforming growth factor beta receptor signaling pathway	involved_in	ISO	RGD:1315646	1624291	PMID:24681597	RGD	PMID:24681597
Fermt1	Rat	positive regulation of transforming growth factor beta receptor signaling pathway	involved_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	positive regulation of wound healing, spreading of epidermal cells	involved_in	ISO	RGD:1315645	1624291	UniProtKB:Q96AC1 PMID:21356350	RGD	PMID:21356350
Fermt1	Rat	positive regulation of wound healing, spreading of epidermal cells	involved_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	cell junction	located_in	ISO	RGD:1315645	1624291	PMID:17012746	RGD	PMID:17012746
Fermt1	Rat	cell junction	located_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	cell periphery	located_in	ISO	RGD:1315645	1624291	PMID:18528435	RGD	PMID:18528435
Fermt1	Rat	cell periphery	located_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	cytoplasm	located_in	ISO	RGD:1315645	1624291	PMID:18528435	RGD	PMID:18528435
Fermt1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	cytosol	located_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	cytosol	located_in	ISO	RGD:1315645	1624291	PMID:17012746	RGD	PMID:17012746
Fermt1	Rat	focal adhesion	located_in	ISO	RGD:1315645	1624291	PMID:18528435	RGD	PMID:18528435
Fermt1	Rat	focal adhesion	located_in	IEA	UniProtKB:Q9BQL6\|ensembl:ENSP00000217289	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	focal adhesion	located_in	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	focal adhesion	is_active_in	IBA	MGI:2443583\|PANTHER:PTN002700591\|UniProtKB:Q9BQL6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fermt1	Rat	focal adhesion	located_in	ISO	RGD:1315646	1624291	PMID:16876785	RGD	PMID:16876785

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	actin filament binding	enables	ISO	RGD:1315646	1624291	PMID:16876785	RGD	PMID:16876785
Fermt1	Rat	actin filament binding	enables	IEA	UniProtKB:P59113\|ensembl:ENSMUSP00000047616	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Fermt1	Rat	integrin binding	enables	IBA	MGI:2147790\|PANTHER:PTN001043969\|WB:WBGene00006836	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fermt1	Rat	integrin mediated signaling pathway		ISO	RGD:1315645	7349373		RGD

Disease Annotations Click to see Annotation Detail View

Atrophy (ISO)

Erythema (ISO)

genetic disease (ISO)

Huntington's disease-like 1 (ISO)

Inosine Triphosphatase Deficiency (ISO)

Kindler syndrome (ISO,ISS)

pantothenate kinase-associated neurodegeneration (ISO)

telangiectasis (ISO)

vesiculobullous skin disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

alpha-Zearalanol (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

chloropicrin (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

DDE (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

diclofenac (EXP)

dicrotophos (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

entinostat (ISO)

fonofos (ISO)

furan (EXP)

furfural (ISO)

glycidol (EXP)

indometacin (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

methapyrilene (ISO)

methylmercury chloride (ISO)

microcystin-LR (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (EXP)

parathion (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

progesterone (ISO)

Ptaquiloside (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

Rutecarpine (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

temozolomide (ISO)

terbufos (ISO)

testosterone (ISO)

tributylstannane (ISO)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

basement membrane organization (IEA,ISO)

biological_process (ND)

cell adhesion (IEA,ISO)

cell-matrix adhesion (IBA)

establishment of epithelial cell polarity (IEA,ISO)

integrin-mediated signaling pathway (IEA)

keratinocyte migration (IEA,ISO)

keratinocyte proliferation (IEA,ISO)

negative regulation of canonical Wnt signaling pathway (IEA,ISO)

negative regulation of gene expression (IEA,ISO)

negative regulation of protein import into nucleus (IEA,ISO)

negative regulation of stem cell proliferation (IEA,ISO)

negative regulation of timing of anagen (IEA,ISO)

positive regulation of cell adhesion mediated by integrin (IEA,ISO)

positive regulation of cell-matrix adhesion (IEA,ISO)

positive regulation of integrin activation (IEA,ISO)

positive regulation of transforming growth factor beta production (IEA,ISO)

positive regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO)

positive regulation of wound healing, spreading of epidermal cells (IEA,ISO)

Cellular Component

cell junction (IEA,ISO)

cell periphery (IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

focal adhesion (IBA,IEA,ISO)

Molecular Function

actin filament binding (IEA,ISO)

integrin binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

integrin mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Talins and kindlins: partners in integrin-mediated adhesion.	Calderwood DA, etal., Nat Rev Mol Cell Biol. 2013 Aug;14(8):503-17. doi: 10.1038/nrm3624. Epub 2013 Jul 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Identification of mutations in a new gene encoding a FERM family protein with a pleckstrin homology domain in Kindler syndrome.	Jobard F, etal., Hum Mol Genet. 2003 Apr 15;12(8):925-35.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:16876785	PMID:17012746	PMID:22623678	PMID:24681597	PMID:28845732	PMID:29677029	PMID:36740252

Genomics

Comparative Map Data

Fermt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	140,624,434 - 140,666,419 (-)	NCBI		GRCr8
mRatBN7.2	3	120,171,301 - 120,213,555 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	120,171,561 - 120,213,555 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	124,066,663 - 124,106,362 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	132,670,283 - 132,712,190 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	130,322,805 - 130,362,509 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	125,566,744 - 125,607,864 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	125,566,643 - 125,607,735 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	132,049,511 - 132,090,550 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	120,699,769 - 120,744,016 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	120,607,515 - 120,645,912 (-)	NCBI
Celera	3	118,957,538 - 118,999,128 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

FERMT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	6,074,845 - 6,123,030 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	6,074,845 - 6,123,214 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	6,055,492 - 6,103,677 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	6,003,492 - 6,052,191 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	6,003,492 - 6,052,191	NCBI
Celera	20	6,126,766 - 6,175,354 (-)	NCBI		Celera
Cytogenetic Map	20	p12.3	NCBI
HuRef	20	6,012,168 - 6,061,355 (-)	NCBI		HuRef
CHM1_1	20	6,055,497 - 6,104,189 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	6,116,428 - 6,164,613 (-)	NCBI		T2T-CHM13v2.0

Fermt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	132,746,097 - 132,787,956 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	132,746,309 - 132,787,826 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	132,904,177 - 132,946,036 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	132,904,389 - 132,945,906 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	132,729,915 - 132,771,772 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	132,595,620 - 132,637,477 (-)	NCBI		MGSCv36	mm8
Celera	2	134,125,730 - 134,167,433 (-)	NCBI		Celera
Cytogenetic Map	2	F2	NCBI
cM Map	2	64.8	NCBI

Fermt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	16,446,934 - 16,483,369 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	16,447,921 - 16,483,221 (-)	NCBI	ChiLan1.0	ChiLan1.0

FERMT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	6,995,642 - 7,045,908 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	6,997,144 - 7,043,349 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	6,063,480 - 6,120,206 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	5,856,287 - 5,902,251 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	5,856,287 - 5,902,251 (-)	Ensembl	panpan1.1		panPan2

FERMT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	15,748,632 - 15,785,025 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	15,748,629 - 15,782,880 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	15,570,788 - 15,607,260 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	16,151,297 - 16,187,696 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	16,153,502 - 16,185,964 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	15,757,632 - 15,794,124 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	15,866,168 - 15,902,611 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	16,197,744 - 16,234,285 (+)	NCBI		UU_Cfam_GSD_1.0

Fermt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	164,550,560 - 164,587,721 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	12,985,552 - 13,016,906 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	12,985,552 - 13,016,997 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FERMT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	15,080,587 - 15,137,753 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	15,080,585 - 15,137,947 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	16,443,838 - 16,504,032 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FERMT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	32,006,824 - 32,060,838 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	32,009,615 - 32,062,211 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666071	12,480,750 - 12,534,757 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fermt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	6,880,877 - 6,915,051 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	6,881,477 - 6,914,910 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fermt1
310 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	225
Count of miRNA genes:	167
Interacting mature miRNAs:	192
Transcripts:	ENSRNOT00000028901
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	84091273	129091273	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1358204	Insglur1	Insulin/glucose ratio QTL 1	3.8		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	3	115638168	135181505	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	8	32	92	66	65	34	24	34	6	172	76	72	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028901 ⟹ ENSRNOP00000028901

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	120,171,561 - 120,213,555 (-)	Ensembl
Rnor_6.0 Ensembl	3	125,566,643 - 125,607,735 (-)	Ensembl

RefSeq Acc Id:

NM_001106515 ⟹ NP_001099985

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	140,624,434 - 140,666,419 (-)	NCBI
mRatBN7.2	3	120,171,561 - 120,213,555 (-)	NCBI
Rnor_6.0	3	125,567,004 - 125,607,864 (-)	NCBI
Rnor_5.0	3	132,049,511 - 132,090,550 (-)	NCBI
RGSC_v3.4	3	120,699,769 - 120,744,016 (-)	RGD
Celera	3	118,957,538 - 118,999,128 (-)	RGD

Sequence:

show sequence

AACTCTGCATAGGTAGACAATTGCAGACAGGAAGGGATTCTCCCTGGCCCCGGGTATCAGTGAC
GAATTTACCTAAGAGGCAGGGAAAACGACTGAGCCTTGGATTCAGGGCCAGTACTGGAGGGCTT
CAGGGTAGCCAGAACGCTGGAGGCCTCCAGGCAAAGCCATATAAAAGTGGAGGCGGGAGGGGTG
GAGTGTATTCCAGGCTGCTTGGCTCCTGCCTGGAGCAGCCCTGCGGCTCCCTTCAACCCTTATT
GTATCTGCAACCTTCTCCTACTCGGAGTGAAAGCAAGACCTAGCAGGCTGGGCTGGACGTGCCC
CCGCCTGCCCGCCCCGCTAGCCTGCTCCGCGACGCTGTGGCCCCGGGACGCGGACTGTGTTTGG
GCGCTGGGCGGCGGGCTCCGGGAGCTCGCACTGGCTGTCGCGAGGTCCCCCGCAACGTCACTCG
ACCCACTGTACCCTTGTGCCGTCCCGCGAGACCCCTGCTCGCCCAAGGCGGCCTCTAAGGAAGC
AGCTGTCCACGTGCGGGCTGCAGACAGGACGCCGGGGTCTCCATAGCAGACACCTGCCTGGACC
ACAATGTTATCATCTGGTGACTTTACATCTGCATCCTGGGAGCTTGTAGTCCGAGTTGACCATG
CAAATGAAGAGCAGCAGACAGACATCACGCTGAGAGTGTCTGGGGACCTGCATATTGGGGGAGT
GATGCTCAAGCTGGTGGAACAGATGAACATAGCCCAAGACTGGTCAGACTTTGCTCTGTGGTGG
GAACAGAAGCGCTGCTGGCTTCTGAAAACGCACTGGACCCTGGACAAGTGTGGAGTCCAGGCCG
ACGCCAAGCTTCTCTTCACCCCTCAGCACAAGATGCTTCGTCTTCGGCTGCCCAACACCAGGAC
AGTGCGGCTTCGAGTCAGCTTTTCTGCTGTGGTGTTTAAGGCTGTAGCTGATATCTGCAAAGTA
CTGAATATCAGAAGACCAGAAGAACTCTCATTGTTAAAGCCTTCTGGTGACTATTGTAAAAAGA
AAAAGAAGAAAGAAAAAAATAGTAAAGAGCCAGTGATTGAAGACATCCTGAACCTGGAAAGTTC
TTCAACAAGCTCGGGTTCCCCAGTAAGCCCTGGCTTGTACAGTAAGACCATGACACCCACATAT
GACCCCATCAACGGGACACCAGCCTTATCCACTATGACTTGGTTTGGTGACAGCCCTTTGACAG
AGCAAAACTGCAGTGTTCTGGCCTTCAGCCAACCTCCTCCATCACCAGAGGTGCTCGCCGAAAT
GTTCCAGCCTCGATCTTTGGTTGACAAAGCCAAGATGAATGCAGGCTGGCTGGACTCCTCGAGG
TCCCTTATGGAGCAAAGCATTCAAGAGGATGAGCAGCTGCTGTTGAGATTTAAATACTACACCT
TCTTTGACTTGAATCCTAAATATGATGCTGTCCGAATTAACCAACTCTACGAGCAAGCCAGATG
GGCTGTTCTCCTGGAGGAAATCGACTGCACAGAAGAAGAAATGTTGATCTTTGCAGCTCTGCAG
TATCACATCAGCAAGCTGTCGCTGTGTGCTGAAATACAGGACTTTGCAACCAAGTCCGAGGTTG
ACGAGGTAGAAGCAGCGTTGTCAAGTTTGGAAGTGACCCTCGAAGGCGGGAAGGCAGACAACAC
TTTGGAGGACATTACTGACATCCCTAAACTGGCAGATTATCTCAAATTATTTAAGCCCAAGAAG
CTAATGTTAAAAGCTTTCAAGCAATACTGGTTTGTCTTTAAAGACACATCTATAGCCTACTTTA
AAAATCAGGAACTCGAACAAGGAGAGCCAATAGAGAAGCTGAACATCAGAGGCTGTGAAATTGT
GCCAGATGTGAATGTAGCAGGGAGAAAATTTGGAATCAAGTTACTAATCCCTGTTGCTGATGGA
ATGAATGAAGTGTATTTGAGATGTGACCATGAGGATCAATATGCCCGGTGGATGGCTGCGTGCA
TCTTGGCCTCGAAGGGTAAAACCATGGCAGACAGCTCCTACCAGCCAGAGGTCGTCAGCATCCT
TTCATTTCTCAAGATGAAAAACCGGAACTCATCACCTCTGGTGGCTTCCAGTCTGGAAAGCATG
GATATGAACCCGGAGTGCTTAGTATCGCCCCGCTGTGCAAAGAAGCACAAGTCTAAACAGCTGG
CAGCCCGGATCCTGGAAGCTCACCACAACGTAGCCCAGATGCCTCTGGTCGAAGCCAAACTGCA
GTTTATCCAGGCATGGCAGTCCTTACCCGAGTTCGGCCTCACTTACTACCTTGTCAGATTTAAA
GGAAGCAAGAAGGATGACATCCTGGGAGTTTCATACAACAGGCTGATTAGAATGGATGCAGTCA
CTGGGATACCAGTTACAACGTGGCGATTTGCCAATATGAAGCAGTGGAATGTCAACTGGGAAAT
CCGGCAGGTGGCAATCGAGTTTGACCAAAATGTCTCCATCGCATTCACCTGCCTAAGTGCAGGT
TGCAAGATTGTACACGAGTACATTGGTGGCTACATCTTCCTGTCCACCCGATCCAAGGATCAAA
ATGAAACGCTCGACGAGGACCTCTTTCACAAACTGACTGGCGGTCAGGACTGAAGTGAAGCAGG
GCTACCTGGCCTACATGGACCTAGGAATCCCTTCCTGAATGAATAGGATCCATGGCTTTCCCTG
TGTGTAGCTTTCAGACCCACACAATGTATGCTTACCATCAGACACCCAGGTCCTTGCCTCGTCT
GAGCACACTGAACGCACCCCTCACCTTACTTTGCCTCCCATTGCCAGCAGTAGACTGGGCTCCT
GCTGGTGTTTCCTATAAAGTGGGTGGGGAATGAGAAGCCTGGTACTTACTCTGTGGATGCTCTA
AGGCCCACCATGGCTTTCCAGCTCTGTGGCTTTGCAGGCACACGTAAGTGCTAACCAACAGCTG
ACCTGCTTATATGCCTCATTGGTAAGTCAGCAGTGAGAAGAGCAAGGTAAAAGCGATGTGTAGC
GAGTACAAATCTCATTCCACACACTCAGGTCCTTCTTAACAAAACTGAGCGTAGCTCTCATCTT
GCCAAAATGGCAGCAGGAGTCTCATCGCCTTTTTTCTTTAGAGGTCAGAGAGATGAGTGGGGAG
GAGCAGGTTACAGTGGTCTTCAGTATCATCAGTTTACGGTGACTGTCACATCTGTTAAGGTGAT
CACTCACCATCTGGTCTAATCATCGGTCCTCATAGTATTGCTGACATGAGAGGCTCCATTCCTA
GGGAATCCCACAGACACAGTGAAGTCCTTCTTAAAGACACAGGGATACATGGGAGCCCATTCTT
AGCCAAGATCCATGACTCGGTCGATTTGATTCTGGACTTGGTCTCAAGAAAACAGACCCAGAAC
TCTGTTAATCAAAAGCACCTTTAAGGAGCTGGAAAGATAGCTTAGCAGTTAAGAGGGCTTGCTG
CTCTTGCAGGGGACCTCAACTGAGTTCCAAGTACCTAGCTTTAAGGGATCTGATGCCTTCTTCT
AAACTCCGTGATCTGTTTCTAGAGTCCACCATGTTGAAGATCTGCTTTCGGAGCCCTGGTTGTC
GGGGTTGTAAGAAAGTGTTCTTCTTCCCATTCAGCTGCATTCTGGAGGTGGAGTCTACCTCTAT
GAGTCTTGCCATTTTCCCTAAACACCTTCAGCTTTGTAAATCACAGGCAGTAACAGACTCTCTG
GGGCTTTTTTTTTTTCCAGTATCATCCCTGTCCTGCTACAAACATAAGCTCTTGACAGCTGCCT
GAATGTCATATTCTGGTTTTTCAGTAGGAAGGAATGAGTGGGTTTTGAGTAGGTAGACTGCAGT
CTCAGAGCTAAAGGGAGGTGTTTTCTTCTGTTGAGACACAGCCTTCTCCTTCCACACACTCAGA
CTGCACAGATAAGACAAGAGCTTTCCTTGAACTCTGCCTCTCTCCTAGGCTGCATGTTTCAGGG
TTTTGGATGGAGCCCAGAGACCTTCAAGCCTCAGCTGTTGCTTTGTTTCCCAACCAAGCCACCT
GGGAAGGGGGAGTTCTGCAATTCCAGGAATCAAGAGACACTCCTGGCTTGAGACCACAGACCTG
AGCCAGAAGAACCTTCTGGAGGTTTCTTTTAGCCTATCCCTAGAGGTGTGTACTCATGAACCTT
TCCAAGTTCCCACTGAATTTCTGGGGCTCAACTTTGCTCAGAAGTACTTTAAGCATTTGGAAGA
TTTGGTTCCCATCACAAAGAACTTAACTTGGGGTGTTTTTATGCAGACACATATGTTAAGTATG
TGCAGTAAACACTCTGGGCTCTACTGTTTAGGCTCTAGGCACTGTACAATATACTCCTAGGTAT
ACCACACTAGGCTGGGCATAGCATATACCCAGTGTGTGTGCCTCTAATCCCAGAACTGAGAAGA
CAGACACAGGCAGACCTCTGTGAGTCTGAGGCCAGCCAGGGCTCCATAATCAGAGCCATTCTCA
AAAAAAAATATTTACATGCTAGAGCCTAGACAGATGTTTGAAATCCTGGTCACGATGACCTCCT
TGATTATTTGTCACCTTGATTACATTTTGCTCATGAGAATTCAGCTTCCCTCCTTCACCCAGAC
CTGGCCTTCAGGTCAGTCCCTCCTTAGCTTTTCATGGTTGGCTGACATTTCCATGAAATGCTTG
GAGGAGTTGGCTGCAGACATTATGCAGTTTTGGGTAGCATTTCTCCCGTGATGACACAGCTACA
TCTCAAAGGAATAAATTGGTATAAGAAGAAAATGTTAAATGCCACAATTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099985	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL80278	(Get FASTA)	NCBI Sequence Viewer
	EDL80279	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028901
	ENSRNOP00000028901.5

RefSeq Acc Id:

NP_001099985 ⟸ NM_001106515

- UniProtKB:

D3ZTV0 (UniProtKB/TrEMBL), A6HQH7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLSSGDFTSASWELVVRVDHANEEQQTDITLRVSGDLHIGGVMLKLVEQMNIAQDWSDFALWWE
QKRCWLLKTHWTLDKCGVQADAKLLFTPQHKMLRLRLPNTRTVRLRVSFSAVVFKAVADICKVL
NIRRPEELSLLKPSGDYCKKKKKKEKNSKEPVIEDILNLESSSTSSGSPVSPGLYSKTMTPTYD
PINGTPALSTMTWFGDSPLTEQNCSVLAFSQPPPSPEVLAEMFQPRSLVDKAKMNAGWLDSSRS
LMEQSIQEDEQLLLRFKYYTFFDLNPKYDAVRINQLYEQARWAVLLEEIDCTEEEMLIFAALQY
HISKLSLCAEIQDFATKSEVDEVEAALSSLEVTLEGGKADNTLEDITDIPKLADYLKLFKPKKL
MLKAFKQYWFVFKDTSIAYFKNQELEQGEPIEKLNIRGCEIVPDVNVAGRKFGIKLLIPVADGM
NEVYLRCDHEDQYARWMAACILASKGKTMADSSYQPEVVSILSFLKMKNRNSSPLVASSLESMD
MNPECLVSPRCAKKHKSKQLAARILEAHHNVAQMPLVEAKLQFIQAWQSLPEFGLTYYLVRFKG
SKKDDILGVSYNRLIRMDAVTGIPVTTWRFANMKQWNVNWEIRQVAIEFDQNVSIAFTCLSAGC
KIVHEYIGGYIFLSTRSKDQNETLDEDLFHKLTGGQD

hide sequence

Ensembl Acc Id:

ENSRNOP00000028901 ⟸ ENSRNOT00000028901

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTV0-F1-model_v2	AlphaFold	D3ZTV0	1-677	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306816	AgrOrtholog
BioCyc Gene	G2FUF-47758	BioCyc
Ensembl Genes	ENSRNOG00000021274	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028901	ENTREZGENE
	ENSRNOT00000028901.7	UniProtKB/TrEMBL
Gene3D-CATH	2.30.29.30	UniProtKB/TrEMBL
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/TrEMBL
InterPro	Band_41_domain	UniProtKB/TrEMBL
	FERM_2	UniProtKB/TrEMBL
	FERM_central	UniProtKB/TrEMBL
	Kindlin/fermitin	UniProtKB/TrEMBL
	Kindlin_2_N	UniProtKB/TrEMBL
	PH_Kindlin/fermitin	UniProtKB/TrEMBL
	PH_type	UniProtKB/TrEMBL
	Pleckstrin_homology	UniProtKB/TrEMBL
KEGG Report	rno:296179	UniProtKB/TrEMBL
NCBI Gene	296179	ENTREZGENE
PANTHER	FERMITIN FAMILY HOMOLOG 1	UniProtKB/TrEMBL
	PTHR16160	UniProtKB/TrEMBL
Pfam	FERM_M	UniProtKB/TrEMBL
	Kindlin_2_N	UniProtKB/TrEMBL
	PF00169	UniProtKB/TrEMBL
PhenoGen	Fermt1	PhenoGen
PROSITE	PH_DOMAIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000021274	RatGTEx
SMART	B41	UniProtKB/TrEMBL
	SM00233	UniProtKB/TrEMBL
Superfamily-SCOP	FERM_3-hlx	UniProtKB/TrEMBL
	PH domain-like	UniProtKB/TrEMBL
UniProt	A6HQH7	ENTREZGENE, UniProtKB/TrEMBL
	D3ZTV0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-02-18	Fermt1	FERM domain containing kindlin 1	Fermt1	fermitin family member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Fermt1	fermitin family member 1	Fermt1	fermitin family homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-23	Fermt1	fermitin family homolog 1 (Drosophila)	RGD1306816	similar to chromosome 20 open reading frame 42; UNC-112 related protein 1; kindlin 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1306816	similar to chromosome 20 open reading frame 42; UNC-112 related protein 1; kindlin 1	RGD1306816_predicted	similar to chromosome 20 open reading frame 42; UNC-112 related protein 1; kindlin 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1306816_predicted	similar to chromosome 20 open reading frame 42; UNC-112 related protein 1; kindlin 1 (predicted)	LOC296179_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC296179_predicted	similar to chromosome 20 open reading frame 42; UNC-112 related protein 1; kindlin 1 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations