Rnf125 (ring finger protein 125) - Rat Genome Database

Name: Rnf125
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rnf125 (ring finger protein 125) Rattus norvegicus

Analyze

Symbol:

Rnf125

Name:

ring finger protein 125

RGD ID:

1306757

Description:

Predicted to enable several functions, including p53 binding activity; ubiquitin conjugating enzyme binding activity; and zinc ion binding activity. Predicted to be involved in negative regulation of RIG-I signaling pathway; negative regulation of type I interferon production; and ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Predicted to be located in Golgi membrane. Predicted to be part of VCP-NPL4-UFD1 AAA ATPase complex. Orthologous to human RNF125 (ring finger protein 125); PARTICIPATES IN Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

E3 ubiquitin-protein ligase RNF125; LOC361296; ring finger protein 125, E3 ubiquitin protein ligase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RNF125 (ring finger protein 125)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Rnf125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rnf125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RNF125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RNF125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rnf125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RNF125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RNF125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rnf125 (ring finger protein 125)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RNF125 (ring finger protein 125)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rnf125 (ring finger protein 125)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rnf125	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	12,254,066 - 12,275,719 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	12,253,852 - 12,275,983 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	12,444,325 - 12,465,962 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	13,231,979 - 13,253,612 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	12,503,627 - 12,525,258 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	15,193,226 - 15,225,454 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	15,192,962 - 15,225,427 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	14,972,530 - 15,004,384 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	12,726,187 - 12,747,639 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	12,738,496 - 12,774,725 (+)	NCBI
Celera	18	12,252,978 - 12,274,631 (+)	NCBI		Celera
Cytogenetic Map	18	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

Tenorio Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

captan (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

cobalt dichloride (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dibenz[a,h]anthracene (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

fenofibrate (ISO)

fluoranthene (ISO)

flutamide (EXP)

folpet (ISO)

furan (EXP)

gadodiamide hydrate (ISO)

genistein (EXP)

gentamycin (EXP)

glafenine (EXP)

hydrogen cyanide (ISO)

indole-3-methanol (EXP)

lipopolysaccharide (ISO)

MeIQx (ISO)

mercury dibromide (ISO)

methapyrilene (EXP)

methimazole (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

N-acetyl-L-cysteine (EXP)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

O-methyleugenol (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium cyanide (ISO)

progesterone (ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

triclosan (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to leukemia inhibitory factor (ISO)

negative regulation of RIG-I signaling pathway (ISO)

negative regulation of type I interferon production (ISO)

protein polyubiquitination (IEA,ISO)

protein ubiquitination (IEA)

ubiquitin-dependent protein catabolic process (ISO)

Cellular Component

Golgi membrane (ISO)

intracellular membrane-bounded organelle (ISO)

VCP-NPL4-UFD1 AAA ATPase complex (ISO)

Molecular Function

p53 binding (ISO)

protein binding (ISO)

ubiquitin conjugating enzyme binding (ISO)

ubiquitin protein ligase activity (ISO)

ubiquitin-protein transferase activity (ISO)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:17460044	PMID:17990982	PMID:20439489	PMID:25591766	PMID:26471729	PMID:27411375	PMID:28036111

Genomics

Comparative Map Data

Rnf125
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	12,254,066 - 12,275,719 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	12,253,852 - 12,275,983 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	12,444,325 - 12,465,962 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	13,231,979 - 13,253,612 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	12,503,627 - 12,525,258 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	15,193,226 - 15,225,454 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	15,192,962 - 15,225,427 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	14,972,530 - 15,004,384 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	12,726,187 - 12,747,639 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	12,738,496 - 12,774,725 (+)	NCBI
Celera	18	12,252,978 - 12,274,631 (+)	NCBI		Celera
Cytogenetic Map	18	p12	NCBI

RNF125
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	32,018,825 - 32,088,144 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	32,018,825 - 32,073,219 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	29,598,788 - 29,653,182 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	27,852,443 - 27,907,152 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	27,852,442 - 27,903,161	NCBI
Celera	18	26,404,874 - 26,460,130 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI
HuRef	18	26,455,131 - 26,510,081 (+)	NCBI		HuRef
CHM1_1	18	29,525,999 - 29,580,720 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	32,209,216 - 32,280,737 (+)	NCBI		T2T-CHM13v2.0

Rnf125
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	21,077,672 - 21,120,416 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	21,077,682 - 21,116,919 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	20,944,615 - 20,987,359 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	20,944,625 - 20,983,862 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	21,103,126 - 21,142,349 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	21,087,635 - 21,126,858 (+)	NCBI		MGSCv36	mm8
Celera	18	21,440,322 - 21,479,523 (+)	NCBI		Celera
Cytogenetic Map	18	A2	NCBI

Rnf125
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	19,295,809 - 19,309,987 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	19,276,157 - 19,310,605 (+)	NCBI	ChiLan1.0	ChiLan1.0

RNF125
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	18	35,088,307 - 35,159,003 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	25,227,353 - 25,297,186 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	28,823,807 - 28,873,667 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	28,824,183 - 28,873,068 (+)	Ensembl	panpan1.1		panPan2

RNF125
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	57,570,779 - 57,607,485 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	57,574,738 - 57,608,017 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	57,004,743 - 57,041,487 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	57,552,615 - 57,589,372 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	57,552,619 - 57,589,286 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	57,229,577 - 57,266,076 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	57,248,867 - 57,285,615 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	57,544,766 - 57,581,517 (-)	NCBI		UU_Cfam_GSD_1.0

Rnf125
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	53,226,460 - 53,267,389 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936682	1,231,823 - 1,268,657 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936682	1,228,903 - 1,268,651 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RNF125
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	115,857,721 - 115,903,677 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	115,857,697 - 115,905,550 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	108,515,308 - 108,583,425 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RNF125
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	48,665,694 - 48,712,371 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	48,666,554 - 48,711,604 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666050	23,218,377 - 23,265,573 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rnf125
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624770	909,808 - 942,386 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rnf125
75 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	59
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000021136
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552968	Pigfal19	Plasma insulin-like growth factor 1 level QTL 19	11.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	18	1	25758124	Rat
9590248	Scort10	Serum corticosterone level QTL 10	19.71	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	1	25758124	Rat
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1641910	Colcr3	Colorectal carcinoma resistance QTL 3	5.02	0.000007	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor surface area measurement (CMO:0002078)	18	2249477	22066430	Rat
1641910	Colcr3	Colorectal carcinoma resistance QTL 3	5.02	0.000007	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	2249477	22066430	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
12904690	Cm129	Cardiac mass QTL 129		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	11944273	26548295	Rat
12904689	Cm128	Cardiac mass QTL 128		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	11944273	26548295	Rat
12904693	Am20	Aortic mass QTL 20		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	11944273	26548295	Rat
12904695	Kidm73	Kidney mass QTL 73		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	11944273	26548295	Rat
12904691	Cm130	Cardiac mass QTL 130		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	11944273	26548295	Rat
12904680	Bw189	Body weight QTL 189		0.019	body mass (VT:0001259)	body weight (CMO:0000012)	18	11944273	26548295	Rat
2301410	Bp317	Blood pressure QTL 317		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944273	26548295	Rat
1331781	Scl28	Serum cholesterol level QTL 28	3.995		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	18	11944299	24797117	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat

Markers in Region

D18Got15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	12,242,712 - 12,242,990 (-)	MAPPER	mRatBN7.2
Rnor_6.0	18	15,236,381 - 15,236,658	NCBI	Rnor6.0
Rnor_5.0	18	15,015,311 - 15,015,588	UniSTS	Rnor5.0
RGSC_v3.4	18	12,714,833 - 12,715,111	RGD	RGSC3.4
RGSC_v3.4	18	12,714,834 - 12,715,111	UniSTS	RGSC3.4
RGSC_v3.1	18	12,741,480 - 12,741,757	RGD
Celera	18	12,241,625 - 12,241,902	UniSTS
RH 3.4 Map	18	116.9	UniSTS
RH 3.4 Map	18	116.9	RGD
RH 2.0 Map	18	764.3	RGD
Cytogenetic Map	18	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			33	25	8	25					15	11
Low	3	43	24	16	11	16	8	10	68	35	26		8
Below cutoff								1	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC162061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000090853 ⟹ ENSRNOP00000070451

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	12,254,093 - 12,275,983 (+)	Ensembl
Rnor_6.0 Ensembl	18	15,192,962 - 15,225,427 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095469 ⟹ ENSRNOP00000082609

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	12,253,852 - 12,273,758 (+)	Ensembl

RefSeq Acc Id:

NM_001108424 ⟹ NP_001101894

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	12,254,066 - 12,275,719 (+)	NCBI
Rnor_6.0	18	15,193,226 - 15,225,454 (-)	NCBI
Rnor_5.0	18	14,972,530 - 15,004,384 (-)	NCBI
RGSC_v3.4	18	12,726,187 - 12,747,639 (+)	RGD
Celera	18	12,252,978 - 12,274,631 (+)	RGD

Sequence:

show sequence

CGGCCGCGCGCTCCGCCTGCGCTCCACCGAGAGGCCCCGCGCCGCGGCTGGCCGATCCAGGAGG
CGGCGATCCGGGCTGGGCCGGGACTTCCTTCCTCCCGGGCGGGACAACAGAACCACCAGCAGCC
CGCTCGGAGCTCCCGGCAGCTTGCTGAGCTACAGCGCAGCGATGGGCTCCCTGCTGAGCAGCGA
CAGCTCCAAGTCCGCTCCAACCTCCTCCGCCCGGCGGACTCTGGAGCGTAGCGGGGACCCGGAG
CTGCCCATCACCTCCTTCGACTGCTCCGTGTGCCTGGAGGTGCTACACCAGCCGGTCCGGACCC
GCTGTGGCCACGTGTTCTGCCGCTCTTGCATTGCAACCAGTATAAAGAACAATAATAAGTGGAC
ATGCCCATACTGCCGCGCGTACCTTCCTTCAGAGGGAGTGCCCGCAACTGACATAGCCAAGAGG
ATGAAGTCAGAATACCAGAACTGTACTGAGTGTGGAACTCTGGTCTGCCTCAGTGACATGAGGG
CGCACATTAGGACGTGTGAGAAGTACATCGATAAATATGGCCCACTGCAAGAGCTTGGAGAGAC
CACTGCAAGATGCGTGTGTCCATTTTGTCAGAGAGAACTGGATGAAGACTGCTTGCTGGATCAT
TGTATTATCCACCACAGATCAGAAAGGAGGCCTGTGTTCTGCCCACTTTGCCATTCACAACCCA
ATGAAAGCCCAAGTACCTTCAGTGGCAGTTTAATTAGACATTTGCAAGTCAGCCACACTTTGTT
TTACGACGATTTCATAGATTTTGATATAATTGAGGAAGCCATTATTCGCAGAGTGTTAGACCGC
TCGCTTCTTGAATATGTGAATCAGTCAAACACCACATAATTTTATGAATAGGATGGGGACCAAT
CACTCCTACCACTAAAGATGCTGCTTGAAGGACTGGAGAGAAATTGCCAATGCTTGATGGAGAA
GCATGTACTACAGTGTTATTCGCTTGTCTCTGTTACGTTGCATTCAAAAACTGTTTTCATTCTG
GTTTGGATCTGCCTTTACGTTCTTGAGTTTATTAGACATTTAACCACAAGGAACGGCCTCCGTC
AGCCACTAGCAGACGGAAGAGACACAGCACAGGCTGGCTATGTGATGGAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101894	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62061	(Get FASTA)	NCBI Sequence Viewer
	EDL76100	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001101894 ⟸ NM_001108424

- UniProtKB:

B1WCA3 (UniProtKB/TrEMBL), A0A0G2JXY7 (UniProtKB/TrEMBL), A0A9K3Y7V2 (UniProtKB/TrEMBL), A0A8I5ZUW9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGSLLSSDSSKSAPTSSARRTLERSGDPELPITSFDCSVCLEVLHQPVRTRCGHVFCRSCIATS
IKNNNKWTCPYCRAYLPSEGVPATDIAKRMKSEYQNCTECGTLVCLSDMRAHIRTCEKYIDKYG
PLQELGETTARCVCPFCQRELDEDCLLDHCIIHHRSERRPVFCPLCHSQPNESPSTFSGSLIRH
LQVSHTLFYDDFIDFDIIEEAIIRRVLDRSLLEYVNQSNTT

hide sequence

RefSeq Acc Id:

ENSRNOP00000070451 ⟸ ENSRNOT00000090853

RefSeq Acc Id:

ENSRNOP00000082609 ⟸ ENSRNOT00000095469

Protein Domains

C2HC RNF-type RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JXY7-F1-model_v2	AlphaFold	A0A0G2JXY7	1-233	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306757	AgrOrtholog
BioCyc Gene	G2FUF-8206	BioCyc
Ensembl Genes	ENSRNOG00000057832	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000070451	ENTREZGENE
	ENSRNOP00000070451.2	UniProtKB/TrEMBL
	ENSRNOP00000082609.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000090853	ENTREZGENE
	ENSRNOT00000090853.2	UniProtKB/TrEMBL
	ENSRNOT00000095469.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7115974	IMAGE-MGC_LOAD
InterPro	Di19_Zn_binding	UniProtKB/TrEMBL
	ZF_C2HC_RNF	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:361296	UniProtKB/TrEMBL
MGC_CLONE	MGC:188062	IMAGE-MGC_LOAD
NCBI Gene	361296	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE RNF125	UniProtKB/TrEMBL
	ZINC FINGER, RING/FYVE/PHD-TYPE	UniProtKB/TrEMBL
Pfam	zf-C3HC4_2	UniProtKB/TrEMBL
	zf-Di19	UniProtKB/TrEMBL
	zf_C2HC_14	UniProtKB/TrEMBL
PhenoGen	Rnf125	PhenoGen
PROSITE	ZF_C2HC_RNF	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
SMART	RING	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A0G2JXY7	ENTREZGENE
	A0A8I5ZUW9	ENTREZGENE, UniProtKB/TrEMBL
	A0A9K3Y7V2	ENTREZGENE, UniProtKB/TrEMBL
	B1WCA3	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A0G2JXY7	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-15	Rnf125	ring finger protein 125	Rnf125	ring finger protein 125, E3 ubiquitin protein ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-07-14	Rnf125	ring finger protein 125, E3 ubiquitin protein ligase	Rnf125	ring finger protein 125	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Rnf125	ring finger protein 125	Rnf125_predicted	ring finger protein 125 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rnf125_predicted	ring finger protein 125 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)