Plac9 (placenta associated 9) - Rat Genome Database

Name: Plac9
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Plac9 (placenta associated 9) Rattus norvegicus

Analyze

Symbol:

Plac9

Name:

placenta associated 9

RGD ID:

1306662

Description:

Orthologous to human PLAC9 (placenta associated 9); INTERACTS WITH 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC361105; placenta-specific 9; placenta-specific protein 9

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PLAC9 (placenta associated 9)	HGNC	Ensembl, Inparanoid, NCBI, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Plac9 (placenta specific 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Plac9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PLAC9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PLAC9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Plac9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PLAC9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PLAC9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Plac9 (placenta associated 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SLC10A6 (solute carrier family 10 member 6)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PLAC9 (placenta associated 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Plac9 (placenta specific 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	1,459,450 - 1,474,275 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	1,459,456 - 1,474,399 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	1,465,768 - 1,480,604 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	2,611,608 - 2,626,440 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	1,472,364 - 1,487,198 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	3,851,107 - 3,866,008 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	3,851,270 - 3,866,008 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	3,817,143 - 3,831,918 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	1,497,710 - 1,512,542 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	1,497,709 - 1,512,571 (-)	NCBI
Celera	16	1,435,621 - 1,450,227 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

chromium(6+) (ISO)

copper atom (EXP)

copper(0) (EXP)

cytarabine (ISO)

decabromodiphenyl ether (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

folic acid (ISO)

gentamycin (EXP)

methimazole (EXP)

methylmercury chloride (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

paraquat (EXP,ISO)

resveratrol (ISO)

SB 431542 (ISO)

tetrachloromethane (EXP,ISO)

topotecan (EXP)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Plac9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	1,459,450 - 1,474,275 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	1,459,456 - 1,474,399 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	1,465,768 - 1,480,604 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	2,611,608 - 2,626,440 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	1,472,364 - 1,487,198 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	3,851,107 - 3,866,008 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	3,851,270 - 3,866,008 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	3,817,143 - 3,831,918 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	1,497,710 - 1,512,542 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	1,497,709 - 1,512,571 (-)	NCBI
Celera	16	1,435,621 - 1,450,227 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

PLAC9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	80,131,661 - 80,145,359 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	80,131,682 - 80,145,359 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	81,891,417 - 81,905,115 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	81,882,238 - 81,894,766 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	10	75,883,196 - 75,895,722 (+)	NCBI		Celera
Cytogenetic Map	10	q22.3	NCBI
HuRef	10	75,735,716 - 75,748,229 (+)	NCBI		HuRef
CHM1_1	10	82,175,228 - 82,187,737 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	81,000,769 - 81,014,482 (+)	NCBI		T2T-CHM13v2.0

Plac9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	25,888,356 - 25,903,339 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	25,887,930 - 25,903,524 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	25,888,403 - 25,902,893 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	25,887,506 - 25,903,100 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	14	26,027,282 - 26,042,711 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	14	26,167,405 - 26,182,480 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	26,707,889 - 26,722,379 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	24,721,587 - 24,736,077 (-)	NCBI		MGSCv36	mm8
MGSCv36	14	20,979,255 - 20,993,744 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	14	A3	NCBI
cM Map	14	15.41	NCBI

Plac9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955437	13,100,613 - 13,113,555 (+)	NCBI	ChiLan1.0	ChiLan1.0

PLAC9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	10	91,757,423 - 91,773,542 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	76,126,851 - 76,139,908 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	78,784,818 - 78,797,760 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	78,784,823 - 78,797,749 (-)	Ensembl	panpan1.1		panPan2

PLAC9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	4	29,399,789 - 29,413,870 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	29,577,078 - 29,591,270 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	4	29,447,041 - 29,461,101 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	29,649,480 - 29,663,787 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	30,003,643 - 30,017,705 (-)	NCBI		UU_Cfam_GSD_1.0

Plac9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	51,721,107 - 51,732,281 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936521	213,830 - 225,006 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PLAC9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	81,889,284 - 81,901,817 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	81,890,265 - 81,901,909 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	88,501,439 - 88,513,083 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PLAC9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	51,665,265 - 51,677,419 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	12,005,984 - 12,018,485 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Plac9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	12,507,948 - 12,521,949 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	12,508,070 - 12,521,886 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Plac9
98 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	66
Count of miRNA genes:	62
Interacting mature miRNAs:	64
Transcripts:	ENSRNOT00000014964
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2325838	Bp347	Blood pressure QTL 347		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	1	3080679	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	9639137	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	380245	2995463	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
12903278	Am16	Aortic mass QTL 16		0.019	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	16	832380	2995225	Rat
12903279	Cm115	Cardiac mass QTL 115		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	16	832380	2995225	Rat
12903281	Cm116	Cardiac mass QTL 116		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	16	832380	2995225	Rat
12903952	Cm117	Cardiac mass QTL 117		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	16	832380	2995225	Rat
12903954	Bw186	Body weight QTL 186		0.011	body mass (VT:0001259)	body weight (CMO:0000012)	16	832380	2995225	Rat
2301404	Bp321	Blood pressure QTL 321		0.05	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	832380	2995225	Rat
12903955	Kidm69	Kidney mass QTL 69		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	832380	4227609	Rat

Markers in Region

RH124641

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	1,474,011 - 1,475,632 (-)	MAPPER	mRatBN7.2
Rnor_6.0	16	3,849,941 - 3,851,561	NCBI	Rnor6.0
Rnor_5.0	16	3,815,984 - 3,817,604	UniSTS	Rnor5.0
Cytogenetic Map	16	p16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		10	1				2	3			15	11	2
Low	3	23	42	27	19	27	6	8	46	32	19		6
Below cutoff		6	12	12		12			26	3	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006252630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039094614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014964 ⟹ ENSRNOP00000014964

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	1,459,456 - 1,474,399 (-)	Ensembl
Rnor_6.0 Ensembl	16	3,851,270 - 3,866,008 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102769 ⟹ ENSRNOP00000097622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	1,459,456 - 1,474,154 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000114500 ⟹ ENSRNOP00000079223

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	1,459,456 - 1,471,553 (-)	Ensembl

RefSeq Acc Id:

NM_001108395 ⟹ NP_001101865

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	1,459,455 - 1,474,275 (-)	NCBI
Rnor_6.0	16	3,851,351 - 3,865,551 (+)	NCBI
Rnor_5.0	16	3,817,143 - 3,831,918 (+)	NCBI
RGSC_v3.4	16	1,497,710 - 1,512,542 (-)	RGD
Celera	16	1,435,621 - 1,450,227 (-)	RGD

Sequence:

show sequence

GCTCGCCCTGCTCCGTGCCGGGGCGGGCGAATGGAGCCAGGGTCCCAGGGACATCCCCGGACGA
CGAGCTGCTGAGTCCCCCAGTGGCCCTGGAGAAGATCTAGCTTGGAGCCCAGGCTGTGACAGAC
ACATGGCTGTCCAAGGCCGGTTGAACATTGTGGAAGAGACGGTGGAGAAGACCGTGGAGCACCT
GGAGGCAGAAGTGACAGGTCTGCTGGGCCTGCTGGAGGAACTGGCTTCAAACCTACCCCCAGGA
CCCTTCAGCCCCAAACCTGACCTGCTTGGAGATGACGGCTTCTGACTACCAGGCATGGTGGAGC
CTATCAGCTGAAGTCATCACTCTGAGAACCAAGCTAGGTTTTCCTGCCTTCCTGCCCCACCATG
GTGTGAAATAAAAGCTACTATCTGGG

hide sequence

RefSeq Acc Id:

XM_039094614 ⟹ XP_038950542

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	1,459,450 - 1,474,072 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101865	(Get FASTA)	NCBI Sequence Viewer
	XP_038950542	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75086	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001101865 ⟸ NM_001108395
- Peptide Label:	precursor
- UniProtKB:	D4A4Q7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVQGRLNIVEETVEKTVEHLEAEVTGLLGLLEELASNLPPGPFSPKPDLLGDDGF hide sequence

RefSeq Acc Id:

ENSRNOP00000014964 ⟸ ENSRNOT00000014964

RefSeq Acc Id:	XP_038950542 ⟸ XM_039094614
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AT08 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000097622 ⟸ ENSRNOT00000102769

RefSeq Acc Id:

ENSRNOP00000079223 ⟸ ENSRNOT00000114500

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4Q7-F1-model_v2	AlphaFold	D4A4Q7	1-109	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306662	AgrOrtholog
BioCyc Gene	G2FUF-12264	BioCyc
Ensembl Genes	ENSRNOG00000011263	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000014964	ENTREZGENE
	ENSRNOP00000014964.5	UniProtKB/TrEMBL
	ENSRNOP00000079223.1	UniProtKB/TrEMBL
	ENSRNOP00000097622	ENTREZGENE
	ENSRNOP00000097622.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014964	ENTREZGENE
	ENSRNOT00000014964.6	UniProtKB/TrEMBL
	ENSRNOT00000102769	ENTREZGENE
	ENSRNOT00000102769.1	UniProtKB/TrEMBL
	ENSRNOT00000114500.1	UniProtKB/TrEMBL
InterPro	PLAC9	UniProtKB/TrEMBL
NCBI Gene	361105	ENTREZGENE
PANTHER	PLACENTA-SPECIFIC PROTEIN 9	UniProtKB/TrEMBL
	PTHR37355	UniProtKB/TrEMBL
Pfam	PLAC9	UniProtKB/TrEMBL
PhenoGen	Plac9	PhenoGen
UniProt	A0A8I5ZMZ4_RAT	UniProtKB/TrEMBL
	A0A8I6AT08	ENTREZGENE, UniProtKB/TrEMBL
	A6KMI2_RAT	UniProtKB/TrEMBL
	D4A4Q7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-03	Plac9	placenta associated 9	Plac9	placenta-specific 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Plac9	placenta-specific 9	Plac9_predicted	placenta-specific 9 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Plac9_predicted	placenta-specific 9 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar