Nt5dc2 (5'-nucleotidase domain containing 2) - Rat Genome Database

Nt5dc2 (5'-nucleotidase domain containing 2) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Nt5dc2 (5'-nucleotidase domain containing 2) Rattus norvegicus

{{ watchLinkText }}

Symbol:

Nt5dc2

Name:

5'-nucleotidase domain containing 2

RGD ID:

1305524

Description:

Predicted to enable 5'-nucleotidase activity. Involved in negative regulation of dopamine biosynthetic process; negative regulation of oxidoreductase activity; and negative regulation of peptidyl-serine phosphorylation. Located in cytoplasm. Orthologous to human NT5DC2 (5'-nucleotidase domain containing 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

Previously known as:

5'-nucleotidase domain-containing protein 2; eye irido-corneal angle unknown protein; LOC290558; MGC95062; RGD1305524; similar to hypothetical protein FLJ12442

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	6,328,925 - 6,336,978 (+)	NCBI		GRCr8
mRatBN7.2	16	6,322,485 - 6,330,538 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	6,322,236 - 6,330,537 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	6,334,474 - 6,342,552 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	7,479,698 - 7,487,777 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	6,341,433 - 6,349,539 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	7,212,488 - 7,220,541 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	7,212,488 - 7,220,540 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	7,141,051 - 7,149,110 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	6,559,619 - 6,567,690 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	6,559,616 - 6,567,687 (+)	NCBI
Celera	16	8,858,685 - 8,866,968 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nt5dc2	Rat	COVID-19		ISO	RGD:1601740	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nt5dc2	Rat	congenital disorder of glycosylation In		ISO	RGD:1601740	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation type 1N	ClinVar	PMID:28492532

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nt5dc2	Rat	17alpha-ethynylestradiol	decreases expression	EXP		6480464	Ethinyl Estradiol results in decreased expression of NT5DC2 mRNA	CTD	PMID:17557909
Nt5dc2	Rat	17alpha-ethynylestradiol	decreases expression	ISO	RGD:1313601	6480464	Ethinyl Estradiol results in decreased expression of NT5DC2 mRNA	CTD	PMID:17555576
Nt5dc2	Rat	17beta-estradiol	increases expression	ISO	RGD:1601740	6480464	Estradiol results in increased expression of NT5DC2 mRNA	CTD	PMID:20106945
Nt5dc2	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of NT5DC2 mRNA	CTD	PMID:32145629
Nt5dc2	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1601740	6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of NT5DC2 mRNA	CTD	PMID:30165855
Nt5dc2	Rat	17beta-estradiol	increases expression	ISO	RGD:1313601	6480464	Estradiol results in increased expression of NT5DC2 mRNA	CTD	PMID:19484750
Nt5dc2	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:1601740	6480464	2,2',4,4'-tetrabromodiphenyl ether analog results in decreased expression of NT5DC2 mRNA	CTD	PMID:19095052
Nt5dc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1601740	6480464	Tetrachlorodibenzodioxin results in increased expression of NT5DC2 mRNA	CTD	PMID:20106945
Nt5dc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of NT5DC2 mRNA	CTD	PMID:33387578
Nt5dc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of NT5DC2 mRNA	CTD	PMID:34747641
Nt5dc2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1313601	6480464	Tetrachlorodibenzodioxin results in decreased expression of NT5DC2 mRNA	CTD	PMID:15034205\|PMID:19770486
Nt5dc2	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of NT5DC2 mRNA	CTD	PMID:21346803
Nt5dc2	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of NT5DC2 mRNA	CTD	PMID:21346803
Nt5dc2	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2,6-dinitrotoluene affects the expression of NT5DC2 mRNA	CTD	PMID:21346803
Nt5dc2	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1313601	6480464	Fenretinide results in decreased expression of NT5DC2 mRNA	CTD	PMID:28973697
Nt5dc2	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1313601	6480464	Fenretinide results in increased expression of NT5DC2 mRNA	CTD	PMID:28973697
Nt5dc2	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of NT5DC2 mRNA	CTD	PMID:24780913
Nt5dc2	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of NT5DC2 mRNA	CTD	PMID:25825206
Nt5dc2	Rat	aflatoxin B1	decreases expression	ISO	RGD:1313601	6480464	Aflatoxin B1 results in decreased expression of NT5DC2 mRNA	CTD	PMID:19770486
Nt5dc2	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of NT5DC2 mRNA	CTD	PMID:25378103
Nt5dc2	Rat	aldehydo-D-glucose	multiple interactions	ISO	RGD:1313601	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ...	CTD	PMID:37567420
Nt5dc2	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1601740	6480464	Tretinoin results in decreased expression of NT5DC2 mRNA	CTD	PMID:33167477
Nt5dc2	Rat	antirheumatic drug	decreases expression	ISO	RGD:1601740	6480464	Antirheumatic Agents results in decreased expression of NT5DC2 mRNA	CTD	PMID:24449571
Nt5dc2	Rat	arsane	multiple interactions	ISO	RGD:1601740	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NT5DC2 more ...	CTD	PMID:39836092
Nt5dc2	Rat	arsenic atom	multiple interactions	ISO	RGD:1601740	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NT5DC2 more ...	CTD	PMID:39836092
Nt5dc2	Rat	atrazine	increases expression	ISO	RGD:1601740	6480464	Atrazine results in increased expression of NT5DC2 mRNA	CTD	PMID:22378314
Nt5dc2	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of NT5DC2 mRNA	CTD	PMID:36841081
Nt5dc2	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1313601	6480464	Benzo(a)pyrene results in decreased expression of NT5DC2 mRNA	CTD	PMID:15034205\|PMID:19770486
Nt5dc2	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1601740	6480464	Benzo(a)pyrene results in increased methylation of NT5DC2 promoter	CTD	PMID:27901495
Nt5dc2	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1313601	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Nt5dc2	Rat	benzo[b]fluoranthene	multiple interactions	ISO	RGD:1313601	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Nt5dc2	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1313601	6480464	Diethylhexyl Phthalate results in increased expression of NT5DC2 mRNA	CTD	PMID:19850644
Nt5dc2	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1601740	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of NT5DC2 more ...	CTD	PMID:33872906
Nt5dc2	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1313601	6480464	PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of NT5DC2 mRNA]	CTD	PMID:19850644
Nt5dc2	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of NT5DC2 mRNA	CTD	PMID:25181051
Nt5dc2	Rat	bisphenol A	affects expression	ISO	RGD:1601740	6480464	bisphenol A affects the expression of NT5DC2 mRNA	CTD	PMID:30903817
Nt5dc2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of NT5DC2 mRNA	CTD	PMID:30816183\|PMID:32145629\|PMID:32528016\|PMID:34947998
Nt5dc2	Rat	bisphenol F	increases expression	ISO	RGD:1601740	6480464	bisphenol F results in increased expression of NT5DC2 mRNA	CTD	PMID:38568856
Nt5dc2	Rat	Butylbenzyl phthalate	decreases expression	ISO	RGD:1313601	6480464	butylbenzyl phthalate results in decreased expression of NT5DC2 mRNA	CTD	PMID:32308655
Nt5dc2	Rat	cadmium atom	multiple interactions	ISO	RGD:1601740	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NT5DC2 more ...	CTD	PMID:35301059
Nt5dc2	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of NT5DC2 promoter	CTD	PMID:22457795
Nt5dc2	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1601740	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NT5DC2 more ...	CTD	PMID:35301059
Nt5dc2	Rat	cannabidiol	decreases expression	ISO	RGD:1601740	6480464	Cannabidiol results in decreased expression of NT5DC2 mRNA	CTD	PMID:33244087
Nt5dc2	Rat	carbon nanotube	increases expression	ISO	RGD:1313601	6480464	Nanotubes, Carbon analog results in increased expression of NT5DC2 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Nt5dc2	Rat	CGP 52608	multiple interactions	ISO	RGD:1601740	6480464	CGP 52608 promotes the reaction [RORA protein binds to NT5DC2 gene]	CTD	PMID:28238834
Nt5dc2	Rat	choline	multiple interactions	ISO	RGD:1313601	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Nt5dc2	Rat	chrysene	multiple interactions	ISO	RGD:1313601	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Nt5dc2	Rat	clobetasol	increases expression	ISO	RGD:1313601	6480464	Clobetasol results in increased expression of NT5DC2 mRNA	CTD	PMID:27462272
Nt5dc2	Rat	clofibrate	multiple interactions	ISO	RGD:1313601	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of NT5DC2 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Nt5dc2	Rat	clofibric acid	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NT5DC2 mRNA	CTD	PMID:17602206
Nt5dc2	Rat	cobalt dichloride	decreases expression	ISO	RGD:1601740	6480464	cobaltous chloride results in decreased expression of NT5DC2 mRNA	CTD	PMID:19320972
Nt5dc2	Rat	copper atom	multiple interactions	ISO	RGD:1601740	6480464	[NSC 689534 binds to Copper] which results in decreased expression of NT5DC2 mRNA	CTD	PMID:20971185
Nt5dc2	Rat	copper atom	multiple interactions	ISO	RGD:1313601	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Nt5dc2	Rat	copper(0)	multiple interactions	ISO	RGD:1601740	6480464	[NSC 689534 binds to Copper] which results in decreased expression of NT5DC2 mRNA	CTD	PMID:20971185
Nt5dc2	Rat	copper(0)	multiple interactions	ISO	RGD:1313601	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ...	CTD	PMID:15467011
Nt5dc2	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1601740	6480464	Copper Sulfate results in decreased expression of NT5DC2 mRNA	CTD	PMID:19549813
Nt5dc2	Rat	crocidolite asbestos	increases expression	ISO	RGD:1313601	6480464	Asbestos, Crocidolite results in increased expression of NT5DC2 mRNA	CTD	PMID:19446018
Nt5dc2	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of NT5DC2 mRNA	CTD	PMID:26577399
Nt5dc2	Rat	cyclosporin A	decreases expression	ISO	RGD:1601740	6480464	Cyclosporine results in decreased expression of NT5DC2 mRNA	CTD	PMID:25562108
Nt5dc2	Rat	D-glucose	multiple interactions	ISO	RGD:1313601	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ...	CTD	PMID:37567420
Nt5dc2	Rat	DDE	increases expression	ISO	RGD:1601740	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of NT5DC2 mRNA	CTD	PMID:38568856
Nt5dc2	Rat	dibutyl phthalate	decreases expression	ISO	RGD:1313601	6480464	Dibutyl Phthalate results in decreased expression of NT5DC2 mRNA	CTD	PMID:21266533
Nt5dc2	Rat	dieldrin	increases expression	EXP		6480464	Dieldrin results in increased expression of NT5DC2 mRNA	CTD	PMID:23153324
Nt5dc2	Rat	dorsomorphin	multiple interactions	ISO	RGD:1601740	6480464	[NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Nt5dc2	Rat	doxorubicin	decreases expression	ISO	RGD:1601740	6480464	Doxorubicin results in decreased expression of NT5DC2 mRNA	CTD	PMID:29803840
Nt5dc2	Rat	elemental selenium	increases expression	ISO	RGD:1601740	6480464	Selenium results in increased expression of NT5DC2 mRNA	CTD	PMID:19244175
Nt5dc2	Rat	elemental selenium	multiple interactions	ISO	RGD:1601740	6480464	[Selenium co-treated with Vitamin E] results in increased expression of NT5DC2 mRNA	CTD	PMID:19244175
Nt5dc2	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of NT5DC2 mRNA	CTD	PMID:29391264
Nt5dc2	Rat	enzyme inhibitor	multiple interactions	ISO	RGD:1601740	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ...	CTD	PMID:23301498
Nt5dc2	Rat	ethanol	affects expression	ISO	RGD:1313601	6480464	Ethanol affects the expression of NT5DC2 mRNA	CTD	PMID:30319688
Nt5dc2	Rat	fenthion	increases expression	ISO	RGD:1313601	6480464	Fenthion results in increased expression of NT5DC2 mRNA	CTD	PMID:34813904
Nt5dc2	Rat	fipronil	decreases expression	EXP		6480464	fipronil results in decreased expression of NT5DC2 mRNA	CTD	PMID:23962444\|PMID:34044035
Nt5dc2	Rat	folic acid	multiple interactions	ISO	RGD:1313601	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Nt5dc2	Rat	formaldehyde	decreases expression	ISO	RGD:1601740	6480464	Formaldehyde results in decreased expression of NT5DC2 mRNA	CTD	PMID:23649840
Nt5dc2	Rat	fructose	multiple interactions	ISO	RGD:1313601	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ...	CTD	PMID:37567420
Nt5dc2	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of NT5DC2 mRNA	CTD	PMID:25539665\|PMID:26194646
Nt5dc2	Rat	glucose	multiple interactions	ISO	RGD:1313601	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] more ...	CTD	PMID:37567420
Nt5dc2	Rat	heptachlor	increases expression	EXP		6480464	Heptachlor results in increased expression of NT5DC2 mRNA	CTD	PMID:23153324
Nt5dc2	Rat	iron dichloride	decreases expression	ISO	RGD:1601740	6480464	ferrous chloride results in decreased expression of NT5DC2 mRNA	CTD	PMID:35984750
Nt5dc2	Rat	L-methionine	multiple interactions	ISO	RGD:1313601	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Nt5dc2	Rat	leflunomide	decreases expression	ISO	RGD:1601740	6480464	leflunomide results in decreased expression of NT5DC2 mRNA	CTD	PMID:28988120
Nt5dc2	Rat	lidocaine	increases expression	EXP		6480464	Lidocaine results in increased expression of NT5DC2 mRNA	CTD	PMID:35283115
Nt5dc2	Rat	methylmercury chloride	increases expression	ISO	RGD:1601740	6480464	methylmercuric chloride results in increased expression of NT5DC2 mRNA	CTD	PMID:26272509
Nt5dc2	Rat	methylmercury chloride	multiple interactions	ISO	RGD:1601740	6480464	[NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Nt5dc2	Rat	methylparaben	increases expression	ISO	RGD:1601740	6480464	methylparaben results in increased expression of NT5DC2 mRNA	CTD	PMID:38568856
Nt5dc2	Rat	mirex	increases expression	EXP		6480464	Mirex results in increased expression of NT5DC2 mRNA	CTD	PMID:23153324
Nt5dc2	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:1601740	6480464	[Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of NT5DC2 more ...	CTD	PMID:33872906
Nt5dc2	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of NT5DC2 mRNA	CTD	PMID:17602206
Nt5dc2	Rat	okadaic acid	decreases expression	ISO	RGD:1601740	6480464	Okadaic Acid results in decreased expression of NT5DC2 mRNA	CTD	PMID:38832940
Nt5dc2	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NT5DC2 mRNA	CTD	PMID:25729387
Nt5dc2	Rat	ozone	increases expression	ISO	RGD:1313601	6480464	Ozone results in increased expression of NT5DC2 mRNA	CTD	PMID:33026818
Nt5dc2	Rat	paracetamol	increases expression	ISO	RGD:1601740	6480464	Acetaminophen results in increased expression of NT5DC2 mRNA	CTD	PMID:22230336
Nt5dc2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of NT5DC2 mRNA	CTD	PMID:33387578
Nt5dc2	Rat	paracetamol	multiple interactions	ISO	RGD:1313601	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of NT5DC2 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Nt5dc2	Rat	paraquat	decreases expression	ISO	RGD:1601740	6480464	Paraquat results in decreased expression of NT5DC2 mRNA	CTD	PMID:35182771
Nt5dc2	Rat	phenobarbital	multiple interactions	ISO	RGD:1313601	6480464	NR1I3 protein affects the reaction [Phenobarbital results in increased expression of NT5DC2 mRNA]	CTD	PMID:19482888
Nt5dc2	Rat	phenobarbital	increases expression	ISO	RGD:1313601	6480464	Phenobarbital results in increased expression of NT5DC2 mRNA	CTD	PMID:19482888
Nt5dc2	Rat	phenobarbital	affects expression	ISO	RGD:1313601	6480464	Phenobarbital affects the expression of NT5DC2 mRNA	CTD	PMID:23091169
Nt5dc2	Rat	phenylmercury acetate	decreases expression	ISO	RGD:1601740	6480464	Phenylmercuric Acetate results in decreased expression of NT5DC2 mRNA	CTD	PMID:26272509
Nt5dc2	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1601740	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Nt5dc2	Rat	pirinixic acid	multiple interactions	ISO	RGD:1313601	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Nt5dc2	Rat	pirinixic acid	increases expression	ISO	RGD:1313601	6480464	pirinixic acid results in increased expression of NT5DC2 mRNA	CTD	PMID:18301758\|PMID:20813756\|PMID:23811191
Nt5dc2	Rat	potassium chromate	decreases expression	ISO	RGD:1601740	6480464	potassium chromate(VI) results in decreased expression of NT5DC2 mRNA	CTD	PMID:22714537
Nt5dc2	Rat	SB 431542	multiple interactions	ISO	RGD:1601740	6480464	[NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Nt5dc2	Rat	selenium atom	increases expression	ISO	RGD:1601740	6480464	Selenium results in increased expression of NT5DC2 mRNA	CTD	PMID:19244175
Nt5dc2	Rat	selenium atom	multiple interactions	ISO	RGD:1601740	6480464	[Selenium co-treated with Vitamin E] results in increased expression of NT5DC2 mRNA	CTD	PMID:19244175
Nt5dc2	Rat	sodium arsenite	increases expression	ISO	RGD:1601740	6480464	sodium arsenite results in increased expression of NT5DC2 mRNA	CTD	PMID:28595984\|PMID:34032870
Nt5dc2	Rat	sodium arsenite	multiple interactions	ISO	RGD:1601740	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NT5DC2 more ...	CTD	PMID:39836092
Nt5dc2	Rat	sodium arsenite	decreases expression	ISO	RGD:1601740	6480464	sodium arsenite results in decreased expression of NT5DC2 mRNA	CTD	PMID:38568856
Nt5dc2	Rat	sodium arsenite	affects methylation	ISO	RGD:1601740	6480464	sodium arsenite affects the methylation of NT5DC2 gene	CTD	PMID:28589171
Nt5dc2	Rat	sodium dichromate	decreases expression	ISO	RGD:1601740	6480464	sodium bichromate results in decreased expression of NT5DC2 mRNA	CTD	PMID:17685462
Nt5dc2	Rat	sunitinib	decreases expression	ISO	RGD:1601740	6480464	Sunitinib results in decreased expression of NT5DC2 mRNA	CTD	PMID:31533062
Nt5dc2	Rat	tamoxifen	affects expression	ISO	RGD:1313601	6480464	Tamoxifen affects the expression of NT5DC2 mRNA	CTD	PMID:20937368
Nt5dc2	Rat	temozolomide	decreases expression	ISO	RGD:1601740	6480464	Temozolomide results in decreased expression of NT5DC2 mRNA	CTD	PMID:31758290
Nt5dc2	Rat	tetrachloromethane	affects expression	ISO	RGD:1313601	6480464	Carbon Tetrachloride affects the expression of NT5DC2 mRNA	CTD	PMID:17484886
Nt5dc2	Rat	tetrachloromethane	increases expression	ISO	RGD:1313601	6480464	Carbon Tetrachloride results in increased expression of NT5DC2 mRNA	CTD	PMID:27339419\|PMID:31919559
Nt5dc2	Rat	tetraphene	multiple interactions	ISO	RGD:1313601	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Nt5dc2	Rat	thimerosal	decreases expression	ISO	RGD:1601740	6480464	Thimerosal results in decreased expression of NT5DC2 mRNA	CTD	PMID:27188386
Nt5dc2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of NT5DC2 mRNA	CTD	PMID:23411599
Nt5dc2	Rat	thiram	decreases expression	ISO	RGD:1601740	6480464	Thiram results in decreased expression of NT5DC2 mRNA	CTD	PMID:38568856
Nt5dc2	Rat	titanium dioxide	decreases methylation	ISO	RGD:1313601	6480464	titanium dioxide results in decreased methylation of NT5DC2 gene	CTD	PMID:35295148
Nt5dc2	Rat	toluene	decreases expression	EXP		6480464	Toluene results in decreased expression of NT5DC2 mRNA	CTD	PMID:22967744
Nt5dc2	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of NT5DC2 mRNA	CTD	PMID:25729387
Nt5dc2	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NT5DC2 mRNA	CTD	PMID:25729387
Nt5dc2	Rat	trichloroethene	increases expression	ISO	RGD:1313601	6480464	Trichloroethylene results in increased expression of NT5DC2 mRNA	CTD	PMID:25549359
Nt5dc2	Rat	trimellitic anhydride	increases expression	ISO	RGD:1313601	6480464	trimellitic anhydride results in increased expression of NT5DC2 mRNA	CTD	PMID:19042947
Nt5dc2	Rat	trovafloxacin	decreases expression	ISO	RGD:1313601	6480464	trovafloxacin results in decreased expression of NT5DC2 mRNA	CTD	PMID:35537566
Nt5dc2	Rat	tunicamycin	increases expression	ISO	RGD:1601740	6480464	Tunicamycin results in increased expression of NT5DC2 mRNA	CTD	PMID:22378314
Nt5dc2	Rat	valproic acid	increases expression	ISO	RGD:1601740	6480464	Valproic Acid results in increased expression of NT5DC2 mRNA	CTD	PMID:23179753
Nt5dc2	Rat	valproic acid	increases methylation	ISO	RGD:1601740	6480464	Valproic Acid results in increased methylation of NT5DC2 gene	CTD	PMID:29154799
Nt5dc2	Rat	vitamin E	multiple interactions	ISO	RGD:1601740	6480464	[Selenium co-treated with Vitamin E] results in increased expression of NT5DC2 mRNA	CTD	PMID:19244175
Nt5dc2	Rat	vitamin E	increases expression	ISO	RGD:1601740	6480464	Vitamin E results in increased expression of NT5DC2 mRNA	CTD	PMID:19244175
Nt5dc2	Rat	zinc atom	increases expression	ISO	RGD:1601740	6480464	Zinc deficiency results in increased expression of NT5DC2 mRNA	CTD	PMID:22171008
Nt5dc2	Rat	zinc(0)	increases expression	ISO	RGD:1601740	6480464	Zinc deficiency results in increased expression of NT5DC2 mRNA	CTD	PMID:22171008

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nt5dc2	Rat	negative regulation of catecholamine metabolic process	involved_in	IMP		408345212	PMID:31279527	UniProt
Nt5dc2	Rat	negative regulation of dopamine biosynthetic process	involved_in	IMP		408345212	PMID:31279527	UniProt
Nt5dc2	Rat	negative regulation of oxidoreductase activity	involved_in	IMP		408345212	PMID:31279527	UniProt
Nt5dc2	Rat	negative regulation of peptidyl-serine phosphorylation	involved_in	IMP		408345212	PMID:31279527	UniProt

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nt5dc2	Rat	cytoplasm	located_in	IDA		408345212	PMID:31279527	UniProt
Nt5dc2	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Nt5dc2	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nt5dc2	Rat	mitochondrion	located_in	ISO	RGD:1601740	9068941	PMID:34800366	FlyBase	PMID:34800366

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nt5dc2	Rat	5'-nucleotidase activity	enables	IBA	MGI:2178563\|PANTHER:PTN000250728\|RGD:2323387\|UniProtKB:O46411\|UniProtKB:P49902\|UniProtKB:Q5ZIZ4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Nt5dc2	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nt5dc2	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Nt5dc2	Rat	protein binding	enables	IPI	UniProtKB:P04177	408345212	PMID:31279527	UniProt
Nt5dc2	Rat	protein binding	enables	IPI	UniProtKB:P04177	408345199	PMID:38382359	UniProt

Molecular Pathway Annotations Click to see Annotation Detail View

BioCyc Pathways

inosine 5'-phosphate degradation	adenosine nucleotides degradation II	UTP and CTP dephosphorylation I	guanosine nucleotides degradation III

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation In (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

clobetasol (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

dibutyl phthalate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

heptachlor (EXP)

iron dichloride (ISO)

L-methionine (ISO)

leflunomide (ISO)

lidocaine (EXP)

methylmercury chloride (ISO)

methylparaben (ISO)

mirex (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (ISO)

trimellitic anhydride (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vitamin E (ISO)

zinc atom (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of catecholamine metabolic process (IMP)

negative regulation of dopamine biosynthetic process (IMP)

negative regulation of oxidoreductase activity (IMP)

negative regulation of peptidyl-serine phosphorylation (IMP)

Cellular Component

cytoplasm (IDA,IEA)

mitochondrion (ISO)

Molecular Function

5'-nucleotidase activity (IBA)

hydrolase activity (IEA)

metal ion binding (IEA)

protein binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Identification by nano-LC-MS/MS of NT5DC2 as a protein binding to tyrosine hydroxylase: Down-regulation of NT5DC2 by siRNA increases catecholamine synthesis in PC12D cells.	Nakashima A, etal., Biochem Biophys Res Commun. 2019 Sep 3;516(4):1060-1065. doi: 10.1016/j.bbrc.2019.06.156. Epub 2019 Jul 3.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Role of NT5DC2 in tyrosine hydroxylase phosphorylation based on the analysis of NT5DC2-binding proteins.	Yamaguchi H, etal., Biochem Biophys Res Commun. 2024 Apr 9;703:149698. doi: 10.1016/j.bbrc.2024.149698. Epub 2024 Feb 15.

Additional References at PubMed

PMID:12477932	PMID:15326124	PMID:15489334	PMID:34800366

Genomics

Comparative Map Data

Nt5dc2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	6,328,925 - 6,336,978 (+)	NCBI		GRCr8
mRatBN7.2	16	6,322,485 - 6,330,538 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	6,322,236 - 6,330,537 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	6,334,474 - 6,342,552 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	7,479,698 - 7,487,777 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	6,341,433 - 6,349,539 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	7,212,488 - 7,220,541 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	7,212,488 - 7,220,540 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	7,141,051 - 7,149,110 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	6,559,619 - 6,567,690 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	6,559,616 - 6,567,687 (+)	NCBI
Celera	16	8,858,685 - 8,866,968 (-)	NCBI		Celera
Cytogenetic Map	16	p16	NCBI

NT5DC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	52,524,387 - 52,535,027 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	52,524,385 - 52,535,054 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	52,558,403 - 52,569,043 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	52,533,443 - 52,557,496 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	52,537,844 - 52,548,598 (-)	NCBI		Celera
Cytogenetic Map	3	p21.1	NCBI
HuRef	3	52,621,260 - 52,631,693 (-)	NCBI		HuRef
CHM1_1	3	52,510,752 - 52,522,876 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	52,557,295 - 52,567,927 (-)	NCBI		T2T-CHM13v2.0

Nt5dc2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	30,853,046 - 30,861,081 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	30,853,010 - 30,861,081 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	31,131,089 - 31,139,124 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	31,131,053 - 31,139,124 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	31,948,039 - 31,952,310 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	29,958,791 - 29,968,185 (+)	NCBI		MGSCv36	mm8
Celera	14	27,393,412 - 27,397,684 (+)	NCBI		Celera
Cytogenetic Map	14	B	NCBI
cM Map	14	19.09	NCBI

Nt5dc2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955430	2,517,943 - 2,526,423 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955430	2,517,943 - 2,526,423 (-)	NCBI	ChiLan1.0	ChiLan1.0

NT5DC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	52,519,179 - 52,529,264 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	52,523,951 - 52,534,037 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	52,466,032 - 52,475,396 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	53,694,012 - 53,703,186 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	53,694,113 - 53,706,537 (-)	Ensembl	panpan1.1		panPan2

NT5DC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	37,241,251 - 37,249,872 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	37,240,038 - 37,249,832 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	37,222,956 - 37,231,703 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	37,590,578 - 37,599,325 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	37,589,615 - 37,599,285 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	36,955,136 - 36,963,877 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	37,363,767 - 37,372,505 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	37,642,003 - 37,650,749 (+)	NCBI		UU_Cfam_GSD_1.0

Nt5dc2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	170,224,563 - 170,234,687 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936473	3,360,009 - 3,373,462 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936473	3,363,134 - 3,372,535 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NT5DC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	34,659,249 - 34,679,535 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	34,659,249 - 34,679,530 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	37,872,007 - 37,876,749 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NT5DC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	13,892,078 - 13,903,043 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	152,998,572 - 153,007,992 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nt5dc2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624822	4,675,430 - 4,685,553 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624822	4,675,430 - 4,684,074 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

.

Variants in Nt5dc2
29 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	42
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000024840
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
1357403	Slep4	Serum leptin concentration QTL 4	3.91		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	9639137	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
737825	Alc13	Alcohol consumption QTL 13	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	16039848	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4227730	17696785	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2301406	Kidm39	Kidney mass QTL 39		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	16	2851709	15884239	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008770986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY569011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088431	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024840 ⟹ ENSRNOP00000024840

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	6,322,236 - 6,330,537 (+)	Ensembl
Rnor_6.0 Ensembl	16	7,212,488 - 7,220,540 (+)	Ensembl

RefSeq Acc Id:

NM_001009271 ⟹ NP_001009271

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	6,328,925 - 6,336,978 (+)	NCBI
mRatBN7.2	16	6,322,485 - 6,330,538 (+)	NCBI
Rnor_6.0	16	7,212,488 - 7,220,541 (+)	NCBI
Rnor_5.0	16	7,141,051 - 7,149,110 (+)	NCBI
RGSC_v3.4	16	6,559,619 - 6,567,690 (+)	RGD
Celera	16	8,858,685 - 8,866,968 (-)	RGD

Sequence:

show sequence

CGGTGGGCAGGCGGGTCAGCGGACGGGCGGAGGGCGGCCGGGGCAGCGCGCAGGGGGCATGGCG
GGTGCGGGACTGCGGGCGGCAGCTAGGCGCTGGCTGCTGTGCGGAGGCCAGGGCGGACCGCGGG
CCGCCTCGTCCTCACCCTCCTGCCCTGGCTGCGGCCCGCCGGGTCCCGGAGCCCACTGCCCCAG
CACCCCGCGCTCGGCGCCCGCAGACGGCGCGGACCTCAGCGCGCACTTGTGGGCTCGTTACCAG
GACATGCGGAGGCTGGTGCACGACCTTCTGCCCCCTGAGGTCTGCAGCCTCTTAAACCCAGCAG
CCATCTATGCCAACAATGAGATCAGCCTGAGCGACGTCGAAGTCTACGGCTTTGACTACGACTA
CACGCTGGCCCAGTACGCAGACGCACTGCACCCTGAGATCTTCAGTGCTGCCCGGGACATCTTG
ATAGAGCACTACAAGTATCCTGAGGGAATTCGGAAGTACGACTATGACCCCAGCTTTGCCATCC
GCGGTCTCCACTACGACATTCAGAAGAGTCTTCTGATGAAGATTGATGCTTTCCATTATGTACA
ACTGGGAACAGCCTACAGGGGCCTCCAGCCTGTGCCCGATGATGAGGTGGTTGACCTGTACGGT
GGCACCCAGCACATCCCACTCTACCAGATGAGCGGCTTCTACGGCAAGGGCCCTTCTATCAAGC
AATTCATGGACATCTTCTCACTCCCAGAGATGGCTCTGCTGTCTTGTGTGGTGGACTACTTTCT
GGGCCACGGCCTAGAGTTTGACCAAGTACACCTCTACAAGGACGTGACGGATGCCATCCGGGAT
GTGCATGTGAAAGGCCTCATGTACCAGTGGATTGAGCAAGACATGGAGAAGTACATCCTGAGAG
GGGATGAAACATTTGCGGTCCTGAGCCGCCTGGTGGCCCATGGGAAACAGCTGTTCCTCATTAC
CAACAGTCCCTTCAGCTTTGTGGACAAAGGGATGCGGCACATGGTGGGTCCCGATTGGCGCCAA
CTCTTCGATGTGGTCATCGTGCAGGCAGACAAGCCCAACTTTTTCACTGACCGGCGCAAGCCTT
TCCGTAAGCTTGACGAGAAGGGCTCCCTCCACTGGGACCGGATCACTCGCTTAGAAAAGGGCAA
GATCTATCGGCAGGGAAACCTGTTTGATTTTCTTCGTCTGACTGAATGGCGAGGGCCACGTGTG
CTCTACTTCGGTGACCACCTTTACAGTGACCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCA
CGGGAGCCATCATCCCTGAGCTGGAGCGCGAGATCCGCATCATCAACACAGAACAGTACATGCA
CTCGCTGACCTGGCAGCAGGCTCTCACGGGGCTGCTGGAACGCATGCAGACTTATCAGGATGCT
GAGTCACGGCAGGTGCTGGCTACCTGGATGAAGGAGCGGCAAGAGCTGAGGTGCATCACGAAGG
CCCTGTTCAACGCTCAGTTTGGGAGCATCTTCCGCACCTTCCACAACCCCACCTACTTCTCCAG
GCGTCTCGTGCGCTTCTCTGACCTCTACATGGCCTCTCTCAGCTGCTTGCTCAACTACAGTGTA
GACTTCACGTTCTACCCACGCCGCACACCTCTGCAGCATGAGGCGCCCCTCTGGATGGACCAGC
TGTGCACCGGCTGCATGAAGACACCCTTTCTTGGTGACATGGCCCACATCCGCTGAGGGCGCTT
TTATTGTCCTGGACAAACTATCGGCCTTTCAGCCACCCTGACAAACAATAAAAGTAGTCTGTGT
CGTCCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008770986 ⟹ XP_008769208

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	6,330,062 - 6,336,978 (+)	NCBI
mRatBN7.2	16	6,325,664 - 6,330,538 (+)	NCBI
Rnor_6.0	16	7,213,374 - 7,220,541 (+)	NCBI

Sequence:

show sequence

TGGGCTGATGAGGCAGGAGATCTGAGTGCCGAACATCTGCCTATTTGTCTGGGTGGGTCTGGTG
GGGCCCTGCCACTGCAGCAGATAGATGTGGTCTGGGCTGTGGCCCCTATCACTGCCCAGCAGAG
TGGCCCTTGGCCTCACACCCTCTGAAGACCCTCAGTGGATTGTGTTGATGACTTTGAAAGGACA
AACCAAGTAGGAACCTGCTGAGCTTCTGGAGGAAGCCACAGGGGTGATAGGCTTGCTTTGTCTG
ATAAGTCCGAGTGGCCCTGACAGGGAGATTCCAGCTGTGACTGGGCTAGGCCTTCCACTCCAGC
TGTGAGGAGAGCTGGACATTGGCCAGAGTTCACCTCTTGACAAGCTGCAGTCAAGAGGGGGTGG
GATGGTGGCGCTACTGAGAATATCCTGAGGGAGGGGGGACCCTTCTGTGCCTTCAGACCCTTAT
AGGCCCTCTGGGTTCTTGTATGCAGGGCCACTTCCACTACCATGCCAGGGTGAGCTAGCTTCAT
GCTTCTGAACCCTGACCCCCCACGCACACATGCACGCACACTCACACACACACTAACACCACCA
CCACACTAGGTTTTCTGAAGGAGTTTGAGCAAAACTGCCAGGGCTCGTAGCCCGTCAGAGAGCA
ATGGAGGACCATCACCTACACTGCTTGGCCTCCTGGGATGAGGAGGCTGGACAGAAGGGTGATT
AAAACAGGCAGAGTGGCCTGAATGTGCATCTCAACTTCGGTGCCAGGGTCTGGGTGGTTTGATC
AGGTGCCCTCACCTCCCTGAGCTTAGCTCTTCTCTGGGCACTGGAGGTGGCAATGTGACTTCAT
GGGACTGGAGGAGGGAAGGAGTTGAGTTTTAAGACTCACGAGTGGTAACTGCCGGAGCCCTAGA
ACCTGAAGGAGGGCTAGACAGTAAAGTCACAAACACAGCAGACTACCTCTGGGTCATGGCATAC
CCTCTCCCGGCTTACCCCACGCACCCAAAGCTATGATTTTCTTGGTCCGGAAATGCGGTAAGCA
GGCCCTGTGTGCTTCTTGCCCACACTCCTTGTTCCAGGAAGGTTTATATGCCCCTGAGAGAGCC
CTTAAAAGCAGTGGCAAGACATAGTGAGAACTCTGCAAGCTTGGACCCACAAAGGCCATGTCTA
CGCTTCCCAACGCAAACAAGTTGACATCCAGGAGTGTAGGGTTGTGGAAATATCCAGCGAGGTG
GGCAGCTGAGGCCCAGGGTCCTCGAGACAGCAGTAAGGGGTGTCTCTGAGGCGGTTCTTTAGAG
AGAGGTGTGTGTTGAGCATATCCGGGCGAAGAGCCTCACTCGGGAATCTTCAGAAGAGCTGCCT
GAGGCCACCGGAGGAACCAGCCACACCTGTTCCCACACCTACACCCTGTGCTTGACACTAAAGG
AAATGGGGGTGGAGCCCTGTGTTCCAGAGGGGCCTCTGAGGCAACAGCTCAGCACGTACAGGAG
GCGTATGCACAGTGCAGCCGCCACGAGACGCACTGGGGAGCCAGAAATTTTTGCTTCATGATCA
GGACTGGTGTGGCTGACAGATTCCCTGGAGGCTCGGACATCAAGTCTATGAGACCATGCCGAGT
CCTGCCTGTTCCCCCTGCTCTAGAAGTGACCAAGGGGATCCCCAGGGCAGGGCTTCTAGCTCAG
AGGTGCATCTGATCTTGTGTATTGTATAGGTTCAGGGCAGAAATACTGCACGAAGTGGGTTGGT
CCCCGCTTTAGTCCCCCTTTTAAAAGAAACTAGCCCAGGGCTAACGTTCTTGAATTCGCAGACA
TGAGAAGGAGGACCTACCTGATCCTGCCTGGCTCACTTCCCCACCCACTTTACCAGCTTTCCGG
ATGGGGAACACAAGGCAGGCAAGCCTAGGGCCCCAGAACCTTCTTGGCACAGCGCAGGGCTTAG
CTTCCCTCTGTGAATCTTTCAGAGGCTTTTGTGACTATCACCAGAAGAGAGCTGGATTGTGTCC
CCAAAACCCGACGTCTTATGTTCCTCCTGTGGTAATTAGCAATGTTCCCTGGCCTTAGCCAGGG
AATGTCATTATGTGGTCTGGCAAGCAGGAGAAATCCGATTAGAGGGGCCTTACTCTCCAGGGCA
TGGCAGGTGTTCCAAATTGGCAGCCTCATGGGCGCTCTGCCCCTGTAATGTTCTTGGGCCCCAT
CCCCAGCCCTGGGCAAAGTGGAAAAGCAACATTCATAGCTGCAGCCTCCAGTCAGGTCAAAAGA
GAGCAATCATCCTCTGGGAGGAGCCCTCAGTCTCTGCATGCTGCCCTTGGCAGGTAACCTCAAG
GAAAGTGAGGCAGACCTTCTGCCCCCTGAGGTCTGCAGCCTCTTAAACCCAGCAGCCATCTATG
CCAACAATGAGATCAGCCTGAGCGACGTCGAAGTCTACGGCTTTGACTACGACTACACGCTGGC
CCAGTACGCAGACGCACTGCACCCTGAGATCTTCAGTGCTGCCCGGGACATCTTGATAGAGCAC
TACAAGTATCCTGAGGGAATTCGGAAGTACGACTATGACCCCAGCTTTGCCATCCGCGGTCTCC
ACTACGACATTCAGAAGAGTCTTCTGATGAAGATTGATGCTTTCCATTATGTACAACTGGGAAC
AGCCTACAGGGGCCTCCAGCCTGTGCCCGATGATGAGGTGGTTGACCTGTACGGTGGCACCCAG
CACATCCCACTCTACCAGATGAGCGGCTTCTACGGCAAGGGCCCTTCTATCAAGCAATTCATGG
ACATCTTCTCACTCCCAGAGATGGCTCTGCTGTCTTGTGTGGTGGACTACTTTCTGGGCCACGG
CCTAGAGTTTGACCAAGTACACCTCTACAAGGACGTGACGGATGCCATCCGGGATGTGCATGTG
AAAGGCCTCATGTACCAGTGGATTGAGCAAGACATGGAGAAGTACATCCTGAGAGGGGATGAAA
CATTTGCGGTCCTGAGCCGCCTGGTGGCCCATGGGAAACAGCTGTTCCTCATTACCAACAGTCC
CTTCAGCTTTGTGGACAAAGGGATGCGGCACATGGTGGGTCCCGATTGGCGCCAACTCTTCGAT
GTGGTCATCGTGCAGGCAGACAAGCCCAACTTTTTCACTGACCGGCGCAAGCCTTTCCGTAAGC
TTGACGAGAAGGGCTCCCTCCACTGGGACCGGATCACTCGCTTAGAAAAGGGCAAGATCTATCG
GCAGGGAAACCTGTTTGATTTTCTTCGTCTGACTGAATGGCGAGGGCCACGTGTGCTCTACTTC
GGTGACCACCTTTACAGTGACCTGGCGGATCTCATGCTGCGGCACGGCTGGCGCACGGGAGCCA
TCATCCCTGAGCTGGAGCGCGAGATCCGCATCATCAACACAGAACAGTACATGCACTCGCTGAC
CTGGCAGCAGGCTCTCACGGGGCTGCTGGAACGCATGCAGACTTATCAGGATGCTGAGTCACGG
CAGGTGCTGGCTACCTGGATGAAGGAGCGGCAAGAGCTGAGGTGCATCACGAAGGCCCTGTTCA
ACGCTCAGTTTGGGAGCATCTTCCGCACCTTCCACAACCCCACCTACTTCTCCAGGCGTCTCGT
GCGCTTCTCTGACCTCTACATGGCCTCTCTCAGCTGCTTGCTCAACTACAGTGTAGACTTCACG
TTCTACCCACGCCGCACACCTCTGCAGCATGAGGCGCCCCTCTGGATGGACCAGCTGTGCACCG
GCTGCATGAAGACACCCTTTCTTGGTGACATGGCCCACATCCGCTGAGGGCGCTTTTATTGTCC
TGGACAAACTATCGGCCTTTCAGCCACCCTGACAAACAATAAAAGTAGTCTGTGTCGTCCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009271	(Get FASTA)	NCBI Sequence Viewer
	XP_008769208	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88431	(Get FASTA)	NCBI Sequence Viewer
	AAS75314	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024840
GenBank Protein	Q6Q0N3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009271 ⟸ NM_001009271

- UniProtKB:

Q5M7U9 (UniProtKB/Swiss-Prot), Q6Q0N3 (UniProtKB/Swiss-Prot), A0A8L2QDA9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGAGLRAAARRWLLCGGQGGPRAASSSPSCPGCGPPGPGAHCPSTPRSAPADGADLSAHLWAR
YQDMRRLVHDLLPPEVCSLLNPAAIYANNEISLSDVEVYGFDYDYTLAQYADALHPEIFSAARD
ILIEHYKYPEGIRKYDYDPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDDEVVDL
YGGTQHIPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVVDYFLGHGLEFDQVHLYKDVTDAI
RDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMRHMVGPDW
RQLFDVVIVQADKPNFFTDRRKPFRKLDEKGSLHWDRITRLEKGKIYRQGNLFDFLRLTEWRGP
RVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQ
DAESRQVLATWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNY
SVDFTFYPRRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR

hide sequence

RefSeq Acc Id:

XP_008769208 ⟸ XM_008770986

- Peptide Label:

isoform X1

- Sequence:

show sequence

MLPLAGNLKESEADLLPPEVCSLLNPAAIYANNEISLSDVEVYGFDYDYTLAQYADALHPEIFS
AARDILIEHYKYPEGIRKYDYDPSFAIRGLHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDDE
VVDLYGGTQHIPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVVDYFLGHGLEFDQVHLYKDV
TDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMRHMV
GPDWRQLFDVVIVQADKPNFFTDRRKPFRKLDEKGSLHWDRITRLEKGKIYRQGNLFDFLRLTE
WRGPRVLYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERM
QTYQDAESRQVLATWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSC
LLNYSVDFTFYPRRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR

hide sequence

Ensembl Acc Id:

ENSRNOP00000024840 ⟸ ENSRNOT00000024840

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6Q0N3-F1-model_v2	AlphaFold	Q6Q0N3	1-553	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

Promoter ID:

Type:

initiation region

Name:

Nt5dc2_1

Description:

5'-nucleotidase domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	7,212,478 - 7,212,538	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305524	AgrOrtholog
BioCyc Gene	G2FUF-12161	BioCyc
BioCyc Pathway	PWY-5695 [inosine 5'-phosphate degradation]	BioCyc
	PWY-6608 [guanosine nucleotides degradation III]	BioCyc
	PWY-7185 [UTP and CTP dephosphorylation I]	BioCyc
	SALVADEHYPOX-PWY [adenosine nucleotides degradation II]	BioCyc
BioCyc Pathway Image	PWY-5695	BioCyc
	PWY-6608	BioCyc
	PWY-7185	BioCyc
	SALVADEHYPOX-PWY	BioCyc
Ensembl Genes	ENSRNOG00000018358	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000024840	ENTREZGENE
Gene3D-CATH	3.40.50.1000	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7124640	IMAGE-MGC_LOAD
InterPro	HAD-like_sf	UniProtKB/Swiss-Prot
	HAD-SF_hydro_IG_5-nucl	UniProtKB/Swiss-Prot
	HAD_sf	UniProtKB/Swiss-Prot
	Pur_nucleotidase	UniProtKB/Swiss-Prot
KEGG Report	rno:290558	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95062	IMAGE-MGC_LOAD
NCBI Gene	290558	ENTREZGENE
PANTHER	5'-NUCLEOTIDASE DOMAIN-CONTAINING PROTEIN 2	UniProtKB/Swiss-Prot
	PTHR12103	UniProtKB/Swiss-Prot
Pfam	5_nucleotid	UniProtKB/Swiss-Prot
PhenoGen	Nt5dc2	PhenoGen
PIRSF	Purine_5'-nucleotidase	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018358	RatGTEx
Superfamily-SCOP	SSF56784	UniProtKB/Swiss-Prot
UniProt	A0A8L2QDA9	ENTREZGENE, UniProtKB/TrEMBL
	NT5D2_RAT	UniProtKB/Swiss-Prot
	Q5M7U9	ENTREZGENE
	Q6Q0N3	ENTREZGENE
UniProt Secondary	Q5M7U9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Nt5dc2	5'-nucleotidase domain containing 2	RGD1305524	similar to hypothetical protein FLJ12442	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1305524	similar to hypothetical protein FLJ12442	RGD1305524_predicted	similar to hypothetical protein FLJ12442 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1305524_predicted	similar to hypothetical protein FLJ12442 (predicted)	LOC290558_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC290558_predicted	similar to hypothetical protein FLJ12442 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL