Advanced Search (OLGA)

Gene: Foxb1 (forkhead box B1) Rattus norvegicus

Analyze

Symbol:

Foxb1

Name:

forkhead box B1

RGD ID:

1305217

Description:

Predicted to enable sequence-specific double-stranded DNA binding activity. Predicted to be involved in several processes, including mammary gland development; nervous system development; and visual learning. Predicted to be located in nucleus. Orthologous to human FOXB1 (forkhead box B1); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

forkhead box protein B1; LOC367106; MGC109378

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FOXB1 (forkhead box B1)	HGNC	NCBI, OrthoDB, Treefam
Mus musculus (house mouse):	Foxb1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Foxb1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FOXB1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FOXB1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Foxb1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FOXB1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FOXB1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Foxb1 (forkhead box B1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FOXB1 (forkhead box B1)	Alliance	DIOPT (HGNC\|OrthoInspector)
Homo sapiens (human):	FOXB1 (forkhead box B1)	Alliance	DIOPT (HGNC\|OrthoInspector\|PhylomeDB)
Mus musculus (house mouse):	Foxb1 (forkhead box B1)	Alliance	DIOPT (OrthoInspector\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	foxb1	Alliance	DIOPT (OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	79,288,161 - 79,290,781 (-)	NCBI		GRCr8
GRCr8 Ensembl	8	79,287,616 - 79,291,490 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	8	70,407,221 - 70,409,841 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	70,408,186 - 70,409,781 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	75,941,662 - 75,944,282 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	74,214,651 - 74,217,271 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	72,053,342 - 72,055,961 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	75,992,751 - 75,995,371 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	75,992,755 - 75,995,371 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	80,317,629 - 80,320,249 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	74,200,271 - 74,202,891 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	71,314,793 - 71,317,413 (+)	NCBI		Celera
RGSC_v3.1	8	74,219,330 - 74,221,945 (-)	NCBI
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

choline (ISO)

flusilazole (ISO)

folic acid (ISO)

fonofos (ISO)

genistein (ISO)

glyphosate (ISO)

hexaconazole (ISO)

iron dichloride (ISO)

L-methionine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

nickel atom (ISO)

paracetamol (ISO)

parathion (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

terbufos (ISO)

titanium dioxide (ISO)

triadimefon (EXP,ISO)

trichostatin A (ISO)

triclosan (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon target recognition (ISO)

cell migration in diencephalon (ISO)

epithelial cell differentiation involved in mammary gland alveolus development (ISO)

floor plate development (ISO)

hypothalamus cell migration (ISO)

inferior colliculus development (ISO)

lactation (ISO)

mammary gland lobule development (ISO)

mammillary body development (ISO)

mammillothalamic axonal tract development (ISO)

midbrain development (ISO)

negative regulation of neuron apoptotic process (ISO)

somitogenesis (ISO)

spinal cord development (ISO)

telencephalon cell migration (ISO)

thalamus development (ISO)

urogenital system development (ISO)

visual learning (ISO)

Cellular Component

nucleus (ISO)

Molecular Function

protein binding (ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8306889	PMID:10662642	PMID:11170346	PMID:15654859	PMID:18064677	PMID:19046377

Genomics

Comparative Map Data

Foxb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	79,288,161 - 79,290,781 (-)	NCBI		GRCr8
GRCr8 Ensembl	8	79,287,616 - 79,291,490 (-)	Ensembl		GRCr8 Ensembl
mRatBN7.2	8	70,407,221 - 70,409,841 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	70,408,186 - 70,409,781 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	75,941,662 - 75,944,282 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	74,214,651 - 74,217,271 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	72,053,342 - 72,055,961 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	75,992,751 - 75,995,371 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	75,992,755 - 75,995,371 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	80,317,629 - 80,320,249 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	74,200,271 - 74,202,891 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	71,314,793 - 71,317,413 (+)	NCBI		Celera
RGSC_v3.1	8	74,219,330 - 74,221,945 (-)	NCBI
Cytogenetic Map	8	q24	NCBI

FOXB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	60,004,311 - 60,007,444 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	60,004,234 - 60,061,730 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	60,296,510 - 60,299,643 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	58,083,713 - 58,085,434 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	58,084,426 - 58,085,434	NCBI
Celera	15	37,184,381 - 37,186,102 (+)	NCBI		Celera
Cytogenetic Map	15	q22.2	NCBI
HuRef	15	37,118,460 - 37,120,181 (+)	NCBI		HuRef
CHM1_1	15	60,414,763 - 60,416,484 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	57,805,997 - 57,809,133 (+)	NCBI		T2T-CHM13v2.0

Foxb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	69,664,992 - 69,668,222 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	69,664,992 - 69,668,222 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	69,757,710 - 69,760,940 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	69,757,710 - 69,760,940 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	69,605,517 - 69,608,747 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	69,556,916 - 69,559,991 (-)	NCBI		MGSCv36	mm8
Celera	9	66,973,932 - 66,977,157 (-)	NCBI		Celera
Cytogenetic Map	9	D	NCBI
cM Map	9	38.76	NCBI

Foxb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955450	14,867,941 - 14,902,990 (-)	NCBI	ChiLan1.0	ChiLan1.0

FOXB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	49,274,911 - 49,277,937 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	53,457,500 - 53,460,525 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	38,979,727 - 38,983,040 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	57,283,337 - 57,286,487 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	57,284,077 - 57,285,054 (+)	Ensembl	panpan1.1		panPan2

FOXB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	24,822,137 - 24,825,833 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	24,823,815 - 24,824,792 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	24,797,514 - 24,798,713 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	24,992,213 - 24,994,850 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	24,992,421 - 24,993,398 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	24,917,815 - 24,920,448 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	25,000,424 - 25,003,058 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	25,187,647 - 25,190,278 (+)	NCBI		UU_Cfam_GSD_1.0

Foxb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	103,085,950 - 103,088,987 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	20,934,580 - 20,935,557 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	20,934,524 - 20,935,584 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FOXB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	111,997,642 - 112,000,550 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	111,997,638 - 112,000,550 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	123,861,407 - 123,864,342 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FOXB1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	23,502,048 - 23,505,390 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	23,503,545 - 23,504,522 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	117,818,793 - 117,822,194 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Foxb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	12,183,444 - 12,185,185 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	12,182,728 - 12,185,228 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Foxb1
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	234
Count of miRNA genes:	156
Interacting mature miRNAs:	171
Transcripts:	ENSRNOT00000014014
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	58991697	91341052	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	58991697	91341052	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	58991697	91341052	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat

Markers in Region

D8Rat140

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	79,292,255 - 79,292,416 (+)	Marker Load Pipeline
mRatBN7.2	8	70,411,315 - 70,411,476 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	75,996,846 - 75,997,006	NCBI	Rnor6.0
Rnor_5.0	8	80,321,724 - 80,321,884	UniSTS	Rnor5.0
RGSC_v3.4	8	74,204,366 - 74,204,526	UniSTS	RGSC3.4
RGSC_v3.4	8	74,204,365 - 74,204,526	RGD	RGSC3.4
Celera	8	71,313,161 - 71,313,318	UniSTS
RGSC_v3.1	8	74,223,239 - 74,223,677	RGD
SHRSP x BN Map	8	44.82	RGD
SHRSP x BN Map	8	44.82	UniSTS
Cytogenetic Map	8	q24	UniSTS

AU047864

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	70,411,263 - 70,411,465 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	75,996,794 - 75,996,995	NCBI	Rnor6.0
Rnor_5.0	8	80,321,672 - 80,321,873	UniSTS	Rnor5.0
RGSC_v3.4	8	74,204,314 - 74,204,515	UniSTS	RGSC3.4
Celera	8	71,313,172 - 71,313,370	UniSTS
Cytogenetic Map	8	q24	UniSTS

UniSTS:489236

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	70,407,931 - 70,409,567 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	75,993,462 - 75,995,097	NCBI	Rnor6.0
Rnor_5.0	8	80,318,340 - 80,319,975	UniSTS	Rnor5.0
RGSC_v3.4	8	74,200,982 - 74,202,617	UniSTS	RGSC3.4
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
3	2	1	80	10	16	1	12	1	20	12	1	80	2	7	15	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014014 ⟹ ENSRNOP00000014014

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	8	75,992,755 - 75,995,371 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112163 ⟹ ENSRNOP00000085628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	70,408,186 - 70,409,781 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000128635 ⟹ ENSRNOP00000106069

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	79,287,616 - 79,291,490 (-)	Ensembl

RefSeq Acc Id:

NM_001013248 ⟹ NP_001013266

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	79,288,161 - 79,290,781 (-)	NCBI
mRatBN7.2	8	70,407,221 - 70,409,841 (-)	NCBI
Rnor_6.0	8	75,992,751 - 75,995,371 (-)	NCBI
Rnor_5.0	8	80,317,629 - 80,320,249 (-)	NCBI
RGSC_v3.4	8	74,200,271 - 74,202,891 (-)	RGD
Celera	8	71,314,793 - 71,317,413 (+)	RGD

Sequence:

show sequence

CATTAATGAAGCGCCGCTACAGGGGTCTTTTCTGCTCCTGTCACCGCTTAAAACTATCAGATGG
TTCGAGGGTGGACATGGAGGCAGCCACCTAGCTCAGCGGAACCACGAACGCCACAGCAGCGTCT
TCTGGATCCCCGAGGCGGCGTCTGCCACTGTCCCCACCCGCACTCCACAGCTGAGTTCGGCCTC
CCAGCAGGACGCAGGACCCAGGAGCGCCGCGGAGCCCGCGGAGAGGAGCTCTACCGGGCTGAGT
CCAAGCCGGGCTGGCAGCGAGTCTCACTGGTCCCCGACTCTGCCATGCAGCCGGTTCCGGCTGC
CTACCCGCTCCCTAACCAGTTAACTACCATGGGCAGCTCTCTAGGCACCGGCTGGCCCCACGTG
TACGGTTCCGCAGGTATGATCGACTCAGCCACCCCAATCTCCATGGCCAGTGGCGACTACAGCG
CCTATGGAGTGCCGCTGAAGCCGCTATGCCACGCCGCAGGCCAGACGTTGCCCGCCATCCCAGT
GCCCATCAAGCCCACTCCGGCCGCAGTGCCCGCGCTGCCAGCGCTGCCGGCACCCATTCCTACC
CTGCTCTCGAACTCGCCGCCTTCTCTCAGCCCCACCTCCTCGCAGACAGCCACTAGCCAAAGCA
GCCCTGCCACCCCTAGCGAGACACTCACCAGCCCGGCCTCCGCCTTGCACTCGGTGGCCGTGCA
CTGACCCACAGAAGCTGGGGCTCCGTCTTAGTCTCATCCACACCATCCCTCTCAACACTTCCCC
GGCTCCGGGTCCAGCCCTCTGCGACCTGAAACCGCCACCCGGACTTGCCCATTCTACCTTCTTC
AGTCCTCGCTCTTAGGAGAACTTTTGATTTTGGACCCAGAAGACAAACCACAAACTTGCCAGAA
GGCGTGTGAAAGTTGTCTGCGTCCCTCTAGGGCAGCAGAGAAAACAGGGGCTAACCCAAGCCAA
GCGGTCCCTCCAGGGTCCCTGAAATGCACTCTCATCCAACAGGCAGAACACCCTGACTCCCTCC
TGCTCGGAGAAAACAGAAACAAAACAAAACAAAATACGCATCTTCTGAGCTTGGATAGGCAGGG
CTCTGGACTCAGCACAATTTCAAGACCAGAGACACTGCCCGAGAGCAGAAGCCTGCCGAGGCTG
CAGCCACAACGTGAAGGCCGGATCTTCTTAGGTCCTGAAAATCTGTGGCCACAGGACCCACTAA
TCATCCACCAGATTCGCCTCCGCCCATCAGGCCGGGATGGGCGGACCGCTGCTTTCCTCGGCTG
CAGCCCTGCCTCCCCGGCTTCTAAAGATTTTTTTTCCCCTTCTGAGTTTTGTTTCCGGCCAGAG
GCTCCCTTAGCTGGGAGTGAGGAGAGAGGCTGCTAAACTTCGGAGGATGCTTGTCCTACTCACA
AGCAAAACACAGCTAAAAGTCACCGTTATTGTTTACAAAGCGCGCGGTTTAAAAAAAATGTAAA
CAGTGAACTTGAGAATCTGCCTGGCTAGGGGCGAGGGGGTAGAGTCCTCTTTACAATTACCTGT
TGTAATGTGAATGTTTACTCTTCTGGCCAGCTTTGGGGGTGGGAAGGAGGTAGGGGGAATGGGG
GAAGTTAATCGGGATGTTAACTTTCTTACTAGTTAGAGACCTTTTTAGCTATTTATTTTGATGA
AAGAGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013266	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89975	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000085628.1
	ENSRNOP00000106069

RefSeq Acc Id:

NP_001013266 ⟸ NM_001013248

- UniProtKB:

A6KEV8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVRGWTWRQPPSSAEPRTPQQRLLDPRGGVCHCPHPHSTAEFGLPAGRRTQERRGARGEELYRA
ESKPGWQRVSLVPDSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDY
SAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQ
SSPATPSETLTSPASALHSVAVH

hide sequence

Ensembl Acc Id:

ENSRNOP00000014014 ⟸ ENSRNOT00000014014

Ensembl Acc Id:

ENSRNOP00000085628 ⟸ ENSRNOT00000112163

Ensembl Acc Id:

ENSRNOP00000106069 ⟸ ENSRNOT00000128635

Protein Domains

Fork-head

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVH9-F1-model_v2	AlphaFold	Q5FVH9	1-215	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305217	AgrOrtholog
BioCyc Gene	G2FUF-29959	BioCyc
Ensembl Genes	ENSRNOG00000010547	Ensembl
	ENSRNOG00000068150	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000089953	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000112163.1	UniProtKB/TrEMBL
	ENSRNOT00000128635	ENTREZGENE
Gene3D-CATH	Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7316995	IMAGE-MGC_LOAD
InterPro	Fork_head_dom	UniProtKB/TrEMBL
	FOX_domain-containing	UniProtKB/TrEMBL
	FOXB1_B2_FH	UniProtKB/TrEMBL
	TF_fork_head_CS_1	UniProtKB/TrEMBL
	TF_fork_head_CS_2	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:367106	UniProtKB/TrEMBL
MGC_CLONE	MGC:109378	IMAGE-MGC_LOAD
NCBI Gene	367106	ENTREZGENE
PANTHER	FORKHEAD BOX PROTEIN	UniProtKB/TrEMBL
	FORKHEAD BOX PROTEIN B1	UniProtKB/TrEMBL
Pfam	Forkhead	UniProtKB/TrEMBL
PhenoGen	Foxb1	PhenoGen
PRINTS	FORKHEAD	UniProtKB/TrEMBL
PROSITE	FORK_HEAD_1	UniProtKB/TrEMBL
	FORK_HEAD_2	UniProtKB/TrEMBL
	FORK_HEAD_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010547	RatGTEx
	ENSRNOG00000068150	RatGTEx
	ENSRNOG00000089953	RatGTEx
SMART	SM00339	UniProtKB/TrEMBL
Superfamily-SCOP	Winged helix' DNA-binding domain	UniProtKB/TrEMBL
UniProt	A0A8I6A4G9_RAT	UniProtKB/TrEMBL
	A6KEV8	ENTREZGENE, UniProtKB/TrEMBL
	Q5FVH9_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Foxb1	forkhead box B1	Foxb1_predicted	forkhead box B1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Foxb1_predicted	forkhead box B1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar