Cidea (cell death-inducing DFFA-like effector a)

Advanced Search (OLGA)

Gene: Cidea (cell death-inducing DFFA-like effector a) Rattus norvegicus

Analyze

Symbol:

Cidea

Name:

cell death-inducing DFFA-like effector a

RGD ID:

1305106

Description:

Predicted to enable lipid transfer activity; phosphatidic acid binding activity; and protein homodimerization activity. Predicted to be involved in several processes, including lipid droplet fusion; negative regulation of cold-induced thermogenesis; and negative regulation of tumor necrosis factor production. Predicted to act upstream of or within lipid metabolic process. Predicted to be located in mitochondrial envelope and nucleus. Predicted to be active in lipid droplet. Human ortholog(s) of this gene implicated in obesity. Orthologous to human CIDEA (cell death inducing DFFA like effector a); INTERACTS WITH (S)-nicotine; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cell death activator CIDE-A; cell death-inducing DNA fragmentation factor, alpha subunit-like effector A; lipid transferase CIDEA; LOC291541

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	63,164,817 - 63,190,384 (+)	NCBI		GRCr8
mRatBN7.2	18	60,894,917 - 60,920,485 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	60,894,874 - 60,920,481 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	62,965,177 - 62,990,782 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,663,950 - 63,689,555 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,515,712 - 61,541,659 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	63,082,861 - 63,108,450 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	63,098,144 - 63,108,051 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	62,268,025 - 62,292,643 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	63,871,538 - 63,896,975 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	63,919,174 - 63,970,178 (+)	NCBI
Celera	18	59,001,666 - 59,027,159 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 18p deletion syndrome (ISO)

congestive heart failure (ISO)

dystonia (ISO)

Experimental Liver Cirrhosis (ISO)

intellectual disability (ISO)

Liver Neoplasms (ISO)

obesity (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R)-pantothenic acid (ISO)

(S)-nicotine (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrophenol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

alcohol (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amiodarone (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (EXP,ISO)

biotin (ISO)

biphenyl-4-amine (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorohydrocarbon (EXP)

chlorpyrifos (ISO)

choline (ISO)

chromium atom (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (ISO)

cocaine (ISO)

Cuprizon (EXP)

delphinidin (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dibutyl phthalate (ISO)

dieldrin (EXP)

diethylstilbestrol (EXP)

dioxygen (ISO)

diuron (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

fructose (EXP)

furosemide (EXP)

gamma-hexachlorocyclohexane (EXP)

Geniposide (ISO)

glycidol (EXP)

graphite (ISO)

harmine (ISO)

imidacloprid (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

indole-3-methanol (EXP)

inulin (ISO)

isoflurane (EXP)

isotretinoin (ISO)

ketoconazole (EXP)

L-methionine (ISO)

Licarin A (ISO)

mangiferin (ISO)

methamphetamine (EXP)

methimazole (EXP)

methylmercury chloride (EXP)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

N,N-diethyl-m-toluamide (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nickel sulfate (ISO)

nicotine (EXP)

nicotinic acid (ISO)

nimesulide (EXP)

orphenadrine (EXP)

oxazepam (ISO)

ozone (EXP,ISO)

p-menthan-3-ol (ISO)

paraquat (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (EXP)

phenobarbital (EXP)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

rotenone (EXP)

scopoletin (EXP)

sodium arsenite (ISO)

streptozocin (EXP,ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

testosterone (EXP)

thioacetamide (EXP)

thyroxine (ISO)

titanium dioxide (ISO)

tolcapone (ISO)

tributylstannane (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (EXP)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

biological_process (ND)

cellular response to cold (ISO)

intermembrane lipid transfer (IEA)

lipid droplet fusion (ISO)

lipid metabolic process (ISO)

lipid storage (ISO)

negative regulation of cold-induced thermogenesis (ISO,ISS)

negative regulation of cytokine production (ISO)

negative regulation of execution phase of apoptosis (ISO)

negative regulation of lipid catabolic process (ISO)

negative regulation of transforming growth factor beta receptor signaling pathway (ISO)

negative regulation of tumor necrosis factor production (ISO)

positive regulation of sequestering of triglyceride (ISO)

regulation of apoptotic DNA fragmentation (ISO)

regulation of apoptotic process (IBA)

response to stilbenoid (ISO)

temperature homeostasis (ISO)

Cellular Component

cytoplasm (ISO)

lipid droplet (ISO)

mitochondrial envelope (ISO)

mitochondrion (ISO)

nucleus (ISO)

Molecular Function

lipid transfer activity (ISO)

phosphatidic acid binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The CIDEA gene V115F polymorphism is associated with obesity in Swedish subjects.	Dahlman I, etal., Diabetes. 2005 Oct;54(10):3032-4.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	Cidea-deficient mice have lean phenotype and are resistant to obesity.	Zhou Z, etal., Nat Genet. 2003 Sep;35(1):49-56. doi: 10.1038/ng1225. Epub 2003 Aug 10.

Additional References at PubMed

PMID:9564035	PMID:15919794	PMID:17080483	PMID:17086191	PMID:18509062	PMID:19577538	PMID:28763438	PMID:33661766

Genomics

Comparative Map Data

Cidea
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	63,164,817 - 63,190,384 (+)	NCBI		GRCr8
mRatBN7.2	18	60,894,917 - 60,920,485 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	60,894,874 - 60,920,481 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	62,965,177 - 62,990,782 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	63,663,950 - 63,689,555 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	61,515,712 - 61,541,659 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	63,082,861 - 63,108,450 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	63,098,144 - 63,108,051 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	62,268,025 - 62,292,643 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	63,871,538 - 63,896,975 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	63,919,174 - 63,970,178 (+)	NCBI
Celera	18	59,001,666 - 59,027,159 (+)	NCBI		Celera
Cytogenetic Map	18	q12.1	NCBI

CIDEA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	12,254,361 - 12,277,595 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	12,254,361 - 12,277,595 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	12,254,360 - 12,277,594 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	12,244,318 - 12,267,594 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	12,244,787 - 12,267,592	NCBI
Celera	18	12,134,265 - 12,157,825 (+)	NCBI		Celera
Cytogenetic Map	18	p11.21	NCBI
HuRef	18	12,208,579 - 12,232,002 (+)	NCBI		HuRef
CHM1_1	18	12,253,696 - 12,277,015 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	18	12,417,352 - 12,440,590 (+)	NCBI		T2T-CHM13v2.0

Cidea
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	67,476,634 - 67,500,864 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	67,476,674 - 67,500,855 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	67,343,564 - 67,367,794 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	67,343,604 - 67,367,785 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	67,503,218 - 67,527,448 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	67,468,974 - 67,493,147 (+)	NCBI		MGSCv36	mm8
Celera	18	68,616,250 - 68,640,339 (+)	NCBI		Celera
Cytogenetic Map	18	E1	NCBI
cM Map	18	39.94	NCBI

Cidea
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	1,090,518 - 1,096,569 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	1,090,372 - 1,096,621 (-)	NCBI	ChiLan1.0	ChiLan1.0

CIDEA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	25,767,841 - 25,793,449 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	11,461,331 - 11,486,053 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	2,051,880 - 2,075,909 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	17,162,126 - 17,185,450 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

CIDEA
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	77,685,383 - 77,703,320 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	77,684,863 - 77,702,934 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	77,086,385 - 77,104,317 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	77,743,846 - 77,761,779 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	77,743,898 - 77,761,770 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	77,440,425 - 77,458,243 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	77,487,476 - 77,505,403 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	77,774,353 - 77,792,294 (+)	NCBI		UU_Cfam_GSD_1.0

Cidea
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	1,002,039 - 1,028,179 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936626	230,329 - 246,893 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936626	230,372 - 246,893 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CIDEA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	97,253,074 - 97,267,405 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	97,253,074 - 97,268,355 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CIDEA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	70,836,188 - 70,853,917 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666050	45,858,688 - 45,878,472 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cidea
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624770	19,559,692 - 19,573,788 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624770	19,559,735 - 19,573,394 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cidea
262 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1298072	Cia26	Collagen induced arthritis QTL 26	3.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	54709769	83828827	Rat
1300125	Rf26	Renal function QTL 26	3.2		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	18	52539863	65844950	Rat
631834	Sach3	Saccharin preference QTL 3	3.9	0.01	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	18	58805687	63636873	Rat
6893683	Bw110	Body weight QTL 110	2.7	0.002	body mass (VT:0001259)	body weight (CMO:0000012)	18	43345022	83828827	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
9589041	Epfw12	Epididymal fat weight QTL 12	17.08	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	18	46640675	83828827	Rat
8694432	Bw165	Body weight QTL 165	3.81	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	46640675	83828827	Rat
70185	BpQTLcluster15	Blood pressure QTL cluster 15	4.61		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	18	59712417	76477814	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331770	Bp234	Blood pressure QTL 234	3.807		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	71893566	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
2301969	Bp324	Blood pressure QTL 324	4.05		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59712417	76477814	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
12880368	Bw187	Body weight QTL 187		0.045	body mass (VT:0001259)	body weight (CMO:0000012)	18	52539763	76104388	Rat
724542	Kidm2	Kidney mass QTL 2	2.6		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	18	59172115	83828827	Rat
61367	Iddm4	Insulin dependent diabetes mellitus QTL 4	2.33	0.0074	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	38192455	83192455	Rat
2293658	Bmd23	Bone mineral density QTL 23	7.3	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	18	51464733	63636873	Rat
1359020	Ppulsi2	Prepulse inhibition QTL 2	2.71		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	18	52292875	73997283	Rat
2312600	Bp341	Blood pressure QTL 341		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	59330409	70263868	Rat
1331752	Bw27	Body weight QTL 27	2.963		body mass (VT:0001259)	body weight (CMO:0000012)	18	52292875	65845095	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
12904069	Cm123	Cardiac mass QTL 123		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	52539763	76104388	Rat
12904070	Cm124	Cardiac mass QTL 124		0.01	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	52539763	76104388	Rat
2303584	Gluco55	Glucose level QTL 55	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	18	48520044	83828827	Rat
12904071	Am18	Aortic mass QTL 18		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	52539763	76104388	Rat
12904067	Cm122	Cardiac mass QTL 122		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	52539763	76104388	Rat
61384	Bp48	Blood pressure QTL 48	19.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	60622311	77209844	Rat
2301417	Bp319	Blood pressure QTL 319		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	52539763	76104388	Rat
12904073	Kidm71	Kidney mass QTL 71		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	52539763	76104388	Rat
6903353	Bp353	Blood pressure QTL 353	2.8		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	59796478	83828827	Rat
738008	Hcar14	Hepatocarcinoma resistance QTL 14	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion number (CMO:0001462)	18	51464733	83218561	Rat
6903356	Bp354	Blood pressure QTL 354	4.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	59796478	83828827	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
8694366	Abfw8	Abdominal fat weight QTL 8	6.38	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	18	46640675	83828827	Rat
631509	Sald2	Serum aldosterone level QTL 2	2.9		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	18	52539763	69140759	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
1600375	Mcs22	Mammary carcinoma susceptibility QTL 22	3.3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	52539763	63933058	Rat
2303571	Bw92	Body weight QTL 92	3		body mass (VT:0001259)	body weight (CMO:0000012)	18	48520044	83828827	Rat
631675	Iddm15	Insulin dependent diabetes mellitus QTL 15			urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	18	60622311	77209844	Rat
1598826	Anxrr20	Anxiety related response QTL 20	3.04		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	18	41432971	83828827	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
7411719	Strs5	Sensitivity to stroke QTL 5	9.4		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	18	49999958	65845095	Rat

Markers in Region

D18Got62

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	60,906,701 - 60,906,914 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	63,094,612 - 63,094,824	NCBI	Rnor6.0
Rnor_5.0	18	62,279,280 - 62,279,492	UniSTS	Rnor5.0
RGSC_v3.4	18	63,883,156 - 63,883,369	RGD	RGSC3.4
RGSC_v3.4	18	63,883,157 - 63,883,369	UniSTS	RGSC3.4
RGSC_v3.1	18	63,956,358 - 63,956,570	RGD
Celera	18	59,013,355 - 59,013,553	UniSTS
RH 3.4 Map	18	618.2	UniSTS
RH 3.4 Map	18	618.2	RGD
RH 2.0 Map	18	296.1	RGD
Cytogenetic Map	18	q12.1	UniSTS

RH128852

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RGSC_v3.4	18	63,896,776 - 63,896,974	UniSTS	RGSC3.4
RH 3.4 Map	18	625.5	UniSTS
Cytogenetic Map	18	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	102	89	88	57	25	57	6	216	97	82	45	59	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001170467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BF284899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CR462136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM041444	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024968 ⟹ ENSRNOP00000024968

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,898,400 - 60,920,481 (+)	Ensembl
Rnor_6.0 Ensembl	18	63,098,144 - 63,108,051 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099378 ⟹ ENSRNOP00000088912

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,906,421 - 60,920,481 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110214 ⟹ ENSRNOP00000095439

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,894,874 - 60,920,481 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112497 ⟹ ENSRNOP00000078103

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,898,584 - 60,920,481 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115288 ⟹ ENSRNOP00000077736

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	60,900,436 - 60,920,481 (+)	Ensembl

RefSeq Acc Id:

NM_001170467 ⟹ NP_001163938

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,164,817 - 63,190,380 (+)	NCBI
mRatBN7.2	18	60,894,917 - 60,920,481 (+)	NCBI
Rnor_6.0	18	63,082,861 - 63,108,450 (+)	NCBI
Rnor_5.0	18	62,268,025 - 62,292,643 (+)	NCBI
RGSC_v3.4	18	63,871,538 - 63,896,975 (+)	RGD
Celera	18	59,001,666 - 59,027,159 (+)	RGD

Sequence:

show sequence

CACCAATGGAGACCGCCAGGGACTACGCGGGAGCCCTCATCAGGCCCCTGACATTCATGGGGTT
GCAGACGAAAAAGGTCCTGCTTACCCCCCTCATACACCCTGCTCGTCCTTTCCGGGTTTCAAAC
CATGACCGAAGCAGCCGGCGTGGGGTGATGGCCAGCAGCCTGCGGGAACTTATCAGCAAGACTC
TGGATGTCTTGGTCATCACAACTGGCCTGGTCACGCTGGTGCTGGAGGAGGATGGTACCGTGGT
GGACACAGAGGAGTTCTTTCAGACCCTAAGAGACAACACACACTTCATGATCTTGGAAAAGGGA
CAGAAATGGACACCGGGCAATAAGTATGTCTGCACACAAACAAAGAAGTCAGGAATAGCCAGAG
TCACCTTCGACCTATACAGGCTGAATCCCAAGGACTTCCTCGGCTGTCTCAATGTCAAAGCCAC
CATGTATGAGATGTACTCAGTGTCGTATGATATCCGCTGCACAAGCTTCAAGGCCTTGTTAAGG
AGTCTGCTGCGGTTCGCATCCTATGCTGCCCAGGTGACCGGACAGTTCCTGGTTTATGCGGGCG
CTTATGTGCTCCGAGCACTGGGTGACACAGAAGAGCAGCCATCCCCCAAGGCTAGCGCCAAAGG
CTGGTTCATGTAATCAGATCACAGATACAGAGGTCCAGGGACCCAGCTTTCACGCAAATTCTCT
ACCATCTGTTACAGGCTGTGGGATGTCAGAGGAAGGAACGGGGTTTGGTGGTGGTACCCAGGGC
AGGACCGAGCAGCAGGATTCCCGCAAGAGAAAGGAGGCAGATGGGCCTTTCAAGAGCTTTAGGA
AGCGACTAACAGCAGAGTGTCTGGGAACATACGAATCAGTCTCTTGCATATTGTAATAAACCAA
ACACAAGACTCGCCAAAAA

hide sequence

RefSeq Acc Id:

XM_039096669 ⟹ XP_038952597

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,168,459 - 63,190,384 (+)	NCBI
mRatBN7.2	18	60,898,548 - 60,920,485 (+)	NCBI

RefSeq Acc Id:

XM_039096670 ⟹ XP_038952598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	63,168,459 - 63,190,384 (+)	NCBI
mRatBN7.2	18	60,898,596 - 60,920,485 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001163938	(Get FASTA)	NCBI Sequence Viewer
	XP_038952597	(Get FASTA)	NCBI Sequence Viewer
	XP_038952598	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM14727	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024968.7
	ENSRNOP00000077736.1
	ENSRNOP00000078103.1
	ENSRNOP00000088912.1
	ENSRNOP00000095439.1

RefSeq Acc Id:

NP_001163938 ⟸ NM_001170467

- UniProtKB:

A0A8I6AJS6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

METARDYAGALIRPLTFMGLQTKKVLLTPLIHPARPFRVSNHDRSSRRGVMASSLRELISKTLD
VLVITTGLVTLVLEEDGTVVDTEEFFQTLRDNTHFMILEKGQKWTPGNKYVCTQTKKSGIARVT
FDLYRLNPKDFLGCLNVKATMYEMYSVSYDIRCTSFKALLRSLLRFASYAAQVTGQFLVYAGAY
VLRALGDTEEQPSPKASAKGWFM

hide sequence

Ensembl Acc Id:

ENSRNOP00000024968 ⟸ ENSRNOT00000024968

RefSeq Acc Id:	XP_038952597 ⟸ XM_039096669
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5Y2E9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038952598 ⟸ XM_039096670
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AJS6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000095439 ⟸ ENSRNOT00000110214

Ensembl Acc Id:

ENSRNOP00000077736 ⟸ ENSRNOT00000115288

Ensembl Acc Id:

ENSRNOP00000088912 ⟸ ENSRNOT00000099378

Ensembl Acc Id:

ENSRNOP00000078103 ⟸ ENSRNOT00000112497

Protein Domains

CIDE-N

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ACH9-F1-model_v2	AlphaFold	D4ACH9	1-182	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305106	AgrOrtholog
BioCyc Gene	G2FUF-7145	BioCyc
Ensembl Genes	ENSRNOG00000018505	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024968.8	UniProtKB/TrEMBL
	ENSRNOT00000099378.1	UniProtKB/TrEMBL
	ENSRNOT00000110214.1	UniProtKB/TrEMBL
	ENSRNOT00000112497.1	UniProtKB/TrEMBL
	ENSRNOT00000115288.1	UniProtKB/TrEMBL
Gene3D-CATH	3.10.20.10	UniProtKB/TrEMBL
InterPro	CAD	UniProtKB/TrEMBL
	CIDE-A	UniProtKB/TrEMBL
NCBI Gene	291541	ENTREZGENE
PANTHER	CELL DEATH ACTIVATOR CIDE	UniProtKB/TrEMBL
	PTHR12306:SF8	UniProtKB/TrEMBL
Pfam	CIDE-N	UniProtKB/TrEMBL
PhenoGen	Cidea	PhenoGen
PROSITE	CIDE_N	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018505	RatGTEx
SMART	CAD	UniProtKB/TrEMBL
Superfamily-SCOP	CAD & PB1 domains	UniProtKB/TrEMBL
UniProt	A0A8I5Y1I8_RAT	UniProtKB/TrEMBL
	A0A8I5Y2E9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AJN5_RAT	UniProtKB/TrEMBL
	A0A8I6AJS6	ENTREZGENE, UniProtKB/TrEMBL
	D4ACH9_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-11-05	Cidea	cell death-inducing DFFA-like effector a	Cidea	cell death-inducing DNA fragmentation factor, alpha subunit-like effector A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Cidea	cell death-inducing DNA fragmentation factor, alpha subunit-like effector A	Cidea_predicted	cell death-inducing DNA fragmentation factor, alpha subunit-like effector A (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Cidea_predicted	cell death-inducing DNA fragmentation factor, alpha subunit-like effector A (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD