Advanced Search (OLGA)

Gene: Ankrd2 (ankyrin repeat domain 2) Rattus norvegicus

Analyze

Symbol:

Ankrd2

Name:

ankyrin repeat domain 2

RGD ID:

1305104

Description:

Predicted to enable several functions, including RNA polymerase II-specific DNA-binding transcription factor binding activity; protein kinase B binding activity; and titin binding activity. Predicted to be involved in negative regulation of myoblast differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including negative regulation of myotube differentiation; regulation of gene expression; and skeletal muscle cell differentiation. Predicted to be located in several cellular components, including I band; PML body; and euchromatin. Predicted to be active in nucleus. Orthologous to human ANKRD2 (ankyrin repeat domain 2); INTERACTS WITH 1,3-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ankyrin repeat domain 2 (stretch responsive muscle); ankyrin repeat domain-containing protein 2; LOC309374

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ANKRD2 (ankyrin repeat domain 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ankrd2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ankrd2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ANKRD2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ANKRD2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ankrd2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ANKRD2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ankrd2 (ankyrin repeat domain 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR3A1 (olfactory receptor family 3 subfamily A member 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ANKRD2 (ankyrin repeat domain 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ANKRD2 (ankyrin repeat domain 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ankrd2 (ankyrin repeat domain 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ankrd2 (ankyrin repeat domain 2 (stretch responsive muscle))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ankrd2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	250,796,419 - 250,805,867 (+)	NCBI		GRCr8
GRCr8 Ensembl	1	250,796,409 - 250,805,870 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	1	240,847,111 - 240,856,563 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	240,847,072 - 240,856,566 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	248,992,499 - 249,001,949 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	255,689,639 - 255,699,091 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	248,342,668 - 248,352,121 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	261,281,859 - 261,291,307 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	261,281,543 - 261,291,394 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	268,734,331 - 268,743,779 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	248,806,966 - 248,816,413 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	236,681,601 - 236,691,048 (+)	NCBI		Celera
RGSC_v3.1	1	249,065,792 - 249,076,206 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,3-dinitrobenzene (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Botulinum toxin type A (EXP)

butanal (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dioxygen (EXP)

doxorubicin (ISO)

esketamine (ISO)

formaldehyde (ISO)

gentamycin (EXP)

ivermectin (ISO)

lead diacetate (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

ochratoxin A (EXP)

okadaic acid (ISO)

ozone (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

propanal (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

spermine (ISO)

streptozocin (ISO)

sulforaphane (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

thiram (ISO)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

trametinib (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

myotube differentiation (ISO)

negative regulation of myoblast differentiation (IEA,ISO)

negative regulation of myotube differentiation (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

regulation of cytokine production (ISO)

regulation of gene expression (IEA)

regulation of intrinsic apoptotic signaling pathway by p53 class mediator (ISO)

regulation of myoblast proliferation (ISO)

regulation of transcription by RNA polymerase II (IBA,ISO)

response to muscle stretch (IEA)

skeletal muscle cell differentiation (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IEA,ISO)

euchromatin (ISO)

I band (IEA,ISO)

myofibril (ISO)

nucleus (IBA,IEA,ISO)

PML body (IEA,ISO)

sarcomere (ISO)

sarcoplasm (ISO)

Molecular Function

chromatin binding (ISO)

protein binding (ISO)

protein kinase B binding (IEA,ISO)

RNA polymerase II-specific DNA-binding transcription factor binding (IBA,ISO)

titin binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12004005	PMID:14741210	PMID:15222314	PMID:17926058	PMID:18302940	PMID:18310072	PMID:21737686	PMID:22147266	PMID:23811403	PMID:23824195	PMID:24434510	PMID:28615162

Genomics

Comparative Map Data

Ankrd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	250,796,419 - 250,805,867 (+)	NCBI		GRCr8
GRCr8 Ensembl	1	250,796,409 - 250,805,870 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	1	240,847,111 - 240,856,563 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	240,847,072 - 240,856,566 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	248,992,499 - 249,001,949 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	255,689,639 - 255,699,091 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	248,342,668 - 248,352,121 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	261,281,859 - 261,291,307 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	261,281,543 - 261,291,394 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	268,734,331 - 268,743,779 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	248,806,966 - 248,816,413 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	236,681,601 - 236,691,048 (+)	NCBI		Celera
RGSC_v3.1	1	249,065,792 - 249,076,206 (-)	NCBI
Cytogenetic Map	1	q54	NCBI

ANKRD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	97,572,441 - 97,583,884 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	97,572,499 - 97,583,884 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	99,332,198 - 99,343,641 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	99,322,246 - 99,333,631 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	99,322,245 - 99,333,629	NCBI
Celera	10	93,069,552 - 93,080,944 (+)	NCBI		Celera
Cytogenetic Map	10	q24.2	NCBI
HuRef	10	92,958,300 - 92,969,691 (+)	NCBI		HuRef
CHM1_1	10	99,613,989 - 99,625,373 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	98,452,620 - 98,464,067 (+)	NCBI		T2T-CHM13v2.0

Ankrd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	42,024,358 - 42,033,550 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	42,024,439 - 42,033,549 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	42,035,917 - 42,045,111 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	42,036,000 - 42,045,110 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	42,110,528 - 42,119,600 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	42,089,349 - 42,098,421 (+)	NCBI		MGSCv36	mm8
Celera	19	42,839,871 - 42,848,982 (+)	NCBI		Celera
Cytogenetic Map	19	C3	NCBI
cM Map	19	35.65	NCBI

Ankrd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955507	3,677,858 - 3,687,979 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955507	3,678,009 - 3,686,967 (+)	NCBI	ChiLan1.0	ChiLan1.0

ANKRD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	109,484,358 - 109,495,996 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	109,489,730 - 109,501,315 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	94,192,920 - 94,204,400 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	97,686,121 - 97,697,250 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	97,686,121 - 97,697,238 (+)	Ensembl	panpan1.1		panPan2

ANKRD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	10,838,677 - 10,848,406 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	10,834,411 - 10,848,406 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	11,023,768 - 11,033,286 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	11,163,651 - 11,173,189 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	11,163,666 - 11,173,159 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	10,824,770 - 10,834,280 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	10,885,482 - 10,894,994 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	11,025,415 - 11,034,945 (+)	NCBI		UU_Cfam_GSD_1.0

Ankrd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	36,086,675 - 36,098,216 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936636	2,125,787 - 2,136,870 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936636	2,125,796 - 2,137,234 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ANKRD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	90,733,138 - 90,745,872 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	51,630,443 - 51,643,309 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ankrd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	9,218,712 - 9,228,319 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	9,219,092 - 9,228,218 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ankrd2
148 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	49
Count of miRNA genes:	48
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000018890
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	160111531	262090437	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	160573753	266453731	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	207243873	252243873	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	186658830	266453731	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	210980612	255980612	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	205233991	267096252	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	218829748	263829748	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	186658830	266453731	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	205233991	267096252	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	210980612	255980612	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	152919152	268496042	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	160111531	262090437	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	200449456	256003563	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	210980612	255980612	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	223134011	262090599	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	210980612	255980612	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	207243873	252243873	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	160111426	262090599	Rat
2314011	Gluco56	Glucose level QTL 56			blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	209203273	254203273	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	228180370	266453608	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	154961463	266453731	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	207243873	252243873	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	238398865	255849249	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	212738576	257738576	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	194786607	262083703	Rat
2292218	Kidm35	Kidney mass QTL 35			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	208798288	253798288	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228180243	255849249	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	160573753	266453731	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	210980612	255980612	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	210980612	255980612	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	207099883	252099883	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	210980612	255980612	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	210980612	255980612	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

AI764749

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	240,845,592 - 240,845,684 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	261,280,341 - 261,280,432	NCBI	Rnor6.0
Rnor_5.0	1	268,732,813 - 268,732,904	UniSTS	Rnor5.0
RGSC_v3.4	1	248,817,840 - 248,817,931	UniSTS	RGSC3.4
Celera	1	236,680,083 - 236,680,174	UniSTS
RH 3.4 Map	1	1620.7	UniSTS
Cytogenetic Map	1	q51-q53	UniSTS
Cytogenetic Map	1	q54	UniSTS

AA849895

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	240,856,363 - 240,856,557 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	261,291,108 - 261,291,301	NCBI	Rnor6.0
Rnor_5.0	1	268,743,580 - 268,743,773	UniSTS	Rnor5.0
RGSC_v3.4	1	248,806,972 - 248,807,165	UniSTS	RGSC3.4
Celera	1	236,690,849 - 236,691,042	UniSTS
RH 3.4 Map	1	1618.32	UniSTS
Cytogenetic Map	1	q51-q53	UniSTS
Cytogenetic Map	1	q54	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
5	11	41	75	55	54	23	24	23	6	168	88	9	55	44	59	31	4	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC131867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216123	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018890 ⟹ ENSRNOP00000018890

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	250,800,231 - 250,805,870 (+)	Ensembl
mRatBN7.2 Ensembl	1	240,847,072 - 240,856,562 (+)	Ensembl
Rnor_6.0 Ensembl	1	261,281,543 - 261,291,394 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109708 ⟹ ENSRNOP00000087179

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	250,796,409 - 250,805,870 (+)	Ensembl
mRatBN7.2 Ensembl	1	240,847,101 - 240,856,566 (+)	Ensembl

RefSeq Acc Id:

NM_001107589 ⟹ NP_001101059

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	250,796,419 - 250,805,867 (+)	NCBI
mRatBN7.2	1	240,847,111 - 240,856,563 (+)	NCBI
Rnor_6.0	1	261,281,859 - 261,291,307 (+)	NCBI
Rnor_5.0	1	268,734,331 - 268,743,779 (+)	NCBI
RGSC_v3.4	1	248,806,966 - 248,816,413 (-)	RGD
Celera	1	236,681,601 - 236,691,048 (+)	RGD

Sequence:

show sequence

GGAAGGCACCATGGAGGGTCCCGAGGCTGTGCAGAGAGCCACAGAGCTCATCGAGCAGCGGCTT
GCCGAGGAGGAAGAGACTGAGAAACTTCGAAGAGCCACTCCTGGGAAGACGTCCATGGACATGC
TAGTGCTAGAGGACGAGAAGCGCCTCGGGGTGCAGAGTCCTGCTTTACAAAAGGTTAAGGGCCA
AGAGCGCGTGCGCAAGACATCCCTGGACTTGCGACGTGAGATCATTGACGTGGGCGGGATCCAG
AACCTCATAGAACTGAGGAAAAAACGCAAGCAGAAAAAGCGAGATGCCCTTGCCGCAGCGCAGG
AACCACCTCCGGAGCCGGAGGAGATCACTGGCCCAGTAGATGAGGAGACATTCCTGAAAGCTGC
GGTGGAGGGGAAAATCAAAGTCATTGACAAGTACCTGGCAGACGGAGGTTCGGCAGACACCTGT
GATGAGTTCCGTCGGACAGCACTGCATCGGGCCTCCCTGGAGGGACACATGGAGATACTGGAGA
AACTTCTGGAGAATGGGGCCACCGTGGACTTCCAGGATCGGCTGGACTGCACAGCCATGCACTG
GGCCTGCCGTGGAGGCCACCTGGAGGTGGTGAAACTCTTGCAAAGTCGGGGGGCCAACACCGAC
GTGAGAGACAAGCTACTGAGCACTCCCCTGCATGTGGCCGTCCGTACTGGACACGTGGAGATTG
TGGAACATTTTCTCTCCCTGGGCTTGGATATCAATGCCAAAGACAGAGAAGGGGACAGTGCCCT
GCATGATGCCGTGAGACTCAACCGCTACAAAATCATCAAACTGCTGCTCTTGCATGGGGCAGAC
ATGATGGCTAAGAATATGGCGGGGAAGACCCCTACCGACCTGGTCCAGCTGTGGCAAGCAGACA
CCCGGCATGCCCTGGAGCACCCTGAACCAGAATCAGAGCAGAACGGATTGGAGAGGCCTGGGAG
TGGCCGGGAGACACCCCAGCCTGTACCAGCCCAGTAAATATCTACCCGGAGCTGGGCACCCGAC
CCGGAGCACCAGACCCCTACTATGAGCTGCCTGAAGCCAAGCTAGCAGGAACATCCCCAGATTC
AACAACACAATAAAGTGCTGGCTTTGCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101059	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94225	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018890.7
	ENSRNOP00000087179
	ENSRNOP00000087179.1

RefSeq Acc Id:

NP_001101059 ⟸ NM_001107589

- UniProtKB:

A6JHA1 (UniProtKB/TrEMBL), D3ZM27 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGPEAVQRATELIEQRLAEEEETEKLRRATPGKTSMDMLVLEDEKRLGVQSPALQKVKGQERV
RKTSLDLRREIIDVGGIQNLIELRKKRKQKKRDALAAAQEPPPEPEEITGPVDEETFLKAAVEG
KIKVIDKYLADGGSADTCDEFRRTALHRASLEGHMEILEKLLENGATVDFQDRLDCTAMHWACR
GGHLEVVKLLQSRGANTDVRDKLLSTPLHVAVRTGHVEIVEHFLSLGLDINAKDREGDSALHDA
VRLNRYKIIKLLLLHGADMMAKNMAGKTPTDLVQLWQADTRHALEHPEPESEQNGLERPGSGRE
TPQPVPAQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000018890 ⟸ ENSRNOT00000018890

Ensembl Acc Id:

ENSRNOP00000087179 ⟸ ENSRNOT00000109708

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZM27-F1-model_v2	AlphaFold	D3ZM27	1-332	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690912

Promoter ID:

EPDNEW_R1437

Type:

single initiation site

Name:

Ankrd2_1

Description:

ankyrin repeat domain 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	261,281,849 - 261,281,909	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305104	AgrOrtholog
BioCyc Gene	G2FUF-55666	BioCyc
Ensembl Genes	ENSRNOG00000013840	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018890.8	UniProtKB/TrEMBL
	ENSRNOT00000109708	ENTREZGENE
	ENSRNOT00000109708.1	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.20	UniProtKB/TrEMBL
InterPro	Ankyrin_rpt	UniProtKB/TrEMBL
	Ankyrin_rpt-contain_sf	UniProtKB/TrEMBL
KEGG Report	rno:309374	UniProtKB/TrEMBL
NCBI Gene	309374	ENTREZGENE
PANTHER	ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN 2	UniProtKB/TrEMBL
	ANKYRIN REPEAT, PH AND SEC7 DOMAIN CONTAINING PROTEIN SECG-RELATED	UniProtKB/TrEMBL
Pfam	Ank	UniProtKB/TrEMBL
	Ank_2	UniProtKB/TrEMBL
	Ank_4	UniProtKB/TrEMBL
PhenoGen	Ankrd2	PhenoGen
PRINTS	ANKYRIN	UniProtKB/TrEMBL
PROSITE	ANK_REP_REGION	UniProtKB/TrEMBL
	ANK_REPEAT	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013840	RatGTEx
SMART	ANK	UniProtKB/TrEMBL
Superfamily-SCOP	ANK	UniProtKB/TrEMBL
UniProt	A0A8I6A2R5_RAT	UniProtKB/TrEMBL
	A6JHA1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZM27	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Ankrd2	ankyrin repeat domain 2	Ankrd2	ankyrin repeat domain 2 (stretch responsive muscle)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Ankrd2	ankyrin repeat domain 2 (stretch responsive muscle)	Ankrd2_predicted	ankyrin repeat domain 2 (stretch responsive muscle) (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Ankrd2_predicted	ankyrin repeat domain 2 (stretch responsive muscle) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message