Hist1h2bq (histone cluster 1 H2B family member Q)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hist1h2bq (histone cluster 1 H2B family member Q) Rattus norvegicus

Analyze

Symbol:

Hist1h2bq

Name:

histone cluster 1 H2B family member Q

RGD ID:

1305011

Description:

Predicted to enable identical protein binding activity. Predicted to be involved in antimicrobial humoral immune response mediated by antimicrobial peptide and innate immune response in mucosa. Predicted to be located in cytosol; extracellular space; and nucleoplasm. Predicted to be part of nucleosome. Orthologous to several human genes including H2BC10 (H2B clustered histone 10); INTERACTS WITH 17beta-estradiol; 4-tert-Octylphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Hist1h2bh; histone 1, H2bh; histone cluster 1, H2bh; histone cluster 1, H2bq; LOC306945

RGD Orthologs

Human

Bonobo

Dog

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	H2BC7 (H2B clustered histone 7)	HGNC	Ensembl, OrthoDB, OrthoMCL
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100979846 (histone H2B type 1-C/E/F/G/I)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	H2BC8 (H2B clustered histone 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	H2BC10 (H2B clustered histone 10)	HGNC	HomoloGene
Homo sapiens (human):	H2BC9 (H2B clustered histone 9)	HGNC	Panther
Homo sapiens (human):	H2BC6 (H2B clustered histone 6)	HGNC	Ensembl
Alliance orthologs ³
Homo sapiens (human):	H2BC10 (H2B clustered histone 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H2BC5 (H2B clustered histone 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H2BC4 (H2B clustered histone 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H2BC8 (H2B clustered histone 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H2BC7 (H2B clustered histone 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H2BC6 (H2B clustered histone 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H2bc8 (H2B clustered histone 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H2bc6 (H2B clustered histone 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H2bc4 (H2B clustered histone 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hist2h2l (histone 2, H2, like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HTB1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HTB2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-34	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-41	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-54	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-66	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG17949	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33868	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33870	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33872	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33874	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33876	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33878	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33880	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33882	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33884	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33886	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33888	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33890	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33892	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33894	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33896	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33898	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33900	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33902	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33904	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33906	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33908	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His2B:CG33910	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-15	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-29	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-44	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-48	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-52	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-58	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-62	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	his-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	h2bc21	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	41,432,100 - 41,441,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	41,429,164 - 41,442,153 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	41,508,561 - 41,517,933 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	43,112,616 - 43,121,988 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	41,391,323 - 41,400,672 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	43,679,925 - 43,689,311 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	43,679,925 - 43,689,311 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	45,534,129 - 45,542,936 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	48,449,574 - 48,459,325 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	48,452,496 - 48,462,010 (+)	NCBI
Celera	17	41,064,490 - 41,073,875 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

17beta-estradiol (EXP)

2-hydroxypropanoic acid (ISO)

4-tert-Octylphenol (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

berberine (ISO)

bisphenol A (EXP,ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

Cuprizon (EXP)

curcumin (EXP)

cyclosporin A (ISO)

diethylstilbestrol (EXP)

doxorubicin (ISO)

endosulfan (EXP)

formaldehyde (ISO)

glycidol (EXP)

graphite (EXP)

isoflavones (EXP)

Licochalcone B (ISO)

lucanthone (ISO)

manganese(II) chloride (EXP)

menadione (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (EXP)

ochratoxin A (EXP)

p-tert-Amylphenol (EXP)

paracetamol (EXP)

pentanal (ISO)

phenethyl isothiocyanate (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium dichromate (EXP)

tetrachloromethane (EXP)

topotecan (EXP)

valproic acid (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

innate immune response in mucosa (ISO)

Cellular Component

cytosol (ISO)

extracellular space (ISO)

nucleoplasm (ISO)

nucleosome (IEA)

nucleus (IEA)

Molecular Function

DNA binding (IEA)

identical protein binding (ISO)

protein binding (ISO)

protein heterodimerization activity (IEA)

structural constituent of chromatin (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:10524764	PMID:12860195	PMID:20458337	PMID:21630459	PMID:23376485	PMID:25954010

Genomics

Comparative Map Data

Hist1h2bq
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	41,432,100 - 41,441,487 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	41,429,164 - 41,442,153 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	41,508,561 - 41,517,933 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	43,112,616 - 43,121,988 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	41,391,323 - 41,400,672 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	43,679,925 - 43,689,311 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	43,679,925 - 43,689,311 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	45,534,129 - 45,542,936 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	48,449,574 - 48,459,325 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	48,452,496 - 48,462,010 (+)	NCBI
Celera	17	41,064,490 - 41,073,875 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

H2BC7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	26,199,516 - 26,199,988 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	26,199,516 - 26,199,988 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	26,199,744 - 26,200,216 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	26,307,766 - 26,308,195 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	26,307,765 - 26,308,195	NCBI
Celera	6	27,429,090 - 27,429,519 (+)	NCBI		Celera
Cytogenetic Map	6	p22.2	NCBI
HuRef	6	26,142,791 - 26,143,220 (+)	NCBI		HuRef
CHM1_1	6	26,201,968 - 26,202,397 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	26,067,982 - 26,068,454 (+)	NCBI		T2T-CHM13v2.0

LOC100979846
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	36,848,768 - 36,849,307 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	26,034,782 - 26,036,003 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	26,695,113 - 26,696,330 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	26,695,177 - 26,695,557 (+)	Ensembl	panpan1.1		panPan2

H2BC8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	24,130,229 - 24,131,736 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	24,131,296 - 24,131,676 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	23,984,338 - 23,985,855 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	24,313,041 - 24,314,561 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	24,178,247 - 24,181,892 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	24,092,926 - 24,094,445 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	24,145,779 - 24,147,302 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	25,610,667 - 25,612,187 (-)	NCBI		UU_Cfam_GSD_1.0

Variants

Variants in Hist1h2bq
37 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	32
Interacting mature miRNAs:	35
Transcripts:	ENSRNOT00000028779
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	41	57	41	18	41	8	10	66	35	34	11	8
Low	1	2			1			1	8		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107352	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF032898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000028779 ⟹ ENSRNOP00000028779

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	17	43,679,925 - 43,689,311 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116857 ⟹ ENSRNOP00000083018

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	41,429,164 - 41,442,153 (-)	Ensembl

RefSeq Acc Id:

NM_001107352 ⟹ NP_001100822

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	41,432,100 - 41,441,487 (-)	NCBI
Rnor_6.0	17	43,679,925 - 43,689,311 (-)	NCBI
Rnor_5.0	17	45,534,129 - 45,542,936 (-)	NCBI
RGSC_v3.4	17	48,449,574 - 48,459,325 (+)	RGD
Celera	17	41,064,490 - 41,073,875 (-)	RGD

Sequence:

show sequence

GAAATCCTTCATTAGCATAAACGCCCTATAAGTAGGAGAAGTCCGTTTCCAATTCACAGTGAGC
TTCCGGTGTTTGGAGATCAGAACATGCCTGAGCCTGCGAAATCTGCTCCCGCCCCGAAGAAGGG
CTCCAAGAAGGCAGTCACCAAGGCGCAGAAGAAGGATGGCAAGAAGCGCAAGCGCAGCCGCAAG
GAGAGCTACTCTGTGTACGTGTACAAGGTGCTGAAGCAAGTGCACCCGGACACAGGCATCTCTT
CCAAGGCCATGGGCATCATGAACTCGTTCGTGAACGACATCTTCGAGCGCATCGCGGGCGAGGC
GTCGCGCTTGGCGCATTACAACAAGCGCTCGACCATCACGTCCCGGGAGATCCAGACAGCCGTG
CGCCTGCTACTGCCCGGTGAATTGGCCAAGCACGCCGTTTCCGAGGGCACCAAGGCGGTCACCA
AGTACACCAGCTCCAAGTAATCGTGCCAAGAGGAGTAGACCTGACATCGTTTCTACCAGTCGTC
GGTGCTGGATGCTGTATCCTCTGACAAACGAGACAGTGGAAATGGCTGATACTAGCAGATTAGC
CGCCATGTTTTCAAAACTCAAGGAACAACCGATAAGCATCTGACTAGAAATTCTATAAAAATGT
TCACTGTAGAAATTCATGATAAAACGACACACATGAGTAGGAAAATAAAATACTCTTAGCAAAA
TTAAAATGCTCCTAGCAAAAGAAAACTTTTAAGTATTTGTGATGTGTGGATATATATGATGTAT
ATATAATAAATAAGTCATGTAAAACAGAACTGCATCATGTTATAAGAATGTAATTTTAAGTAAC
TATGTTTAGAAATCATGATTTATGCATCAATGCTTATGTAATTGCTTTGTGTTTTTAGTTACTT
TGAGTCCCTATTTTTGTGGAATACGAATGTACAAATCACAAATTGTTATTTAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100822	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC98917	(Get FASTA)	NCBI Sequence Viewer
	EDL86577	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001100822 ⟸ NM_001107352
- UniProtKB:	G3V8B3 (UniProtKB/TrEMBL), G3V9C7 (UniProtKB/TrEMBL), A6KLP6 (UniProtKB/TrEMBL), A0A8I6AGQ8 (UniProtKB/TrEMBL), A6KNB9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMN SFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK hide sequence

RefSeq Acc Id:

ENSRNOP00000028779 ⟸ ENSRNOT00000028779

RefSeq Acc Id:

ENSRNOP00000083018 ⟸ ENSRNOT00000116857

Protein Domains

Histone H2A/H2B/H3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V8B3-F1-model_v2	AlphaFold	G3V8B3	1-126	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305011	AgrOrtholog
BioCyc Gene	G2FUF-9376	BioCyc
Ensembl Genes	ENSRNOG00000021198	Ensembl
	ENSRNOG00000064011	UniProtKB/TrEMBL
	ENSRNOG00000069578	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000070362	UniProtKB/TrEMBL
	ENSRNOG00000070916	UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000069660.2	UniProtKB/TrEMBL
	ENSRNOP00000083018	ENTREZGENE
	ENSRNOP00000083018.1	UniProtKB/TrEMBL
	ENSRNOP00000091074.1	UniProtKB/TrEMBL
	ENSRNOP00000092229.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000089643.2	UniProtKB/TrEMBL
	ENSRNOT00000097860.1	UniProtKB/TrEMBL
	ENSRNOT00000101742.1	UniProtKB/TrEMBL
	ENSRNOT00000116857	ENTREZGENE
	ENSRNOT00000116857.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.20.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7121683	IMAGE-MGC_LOAD
InterPro	Histone-fold	UniProtKB/TrEMBL
	Histone_H2A/H2B/H3	UniProtKB/TrEMBL
	Histone_H2B	UniProtKB/TrEMBL
KEGG Report	rno:100910200	UniProtKB/TrEMBL
	rno:306945	UniProtKB/TrEMBL
	rno:680312	UniProtKB/TrEMBL
MGC_CLONE	MGC:95013	IMAGE-MGC_LOAD
NCBI Gene	306945	ENTREZGENE
PANTHER	HISTONE H2B TYPE 1-J	UniProtKB/TrEMBL
	PTHR23428	UniProtKB/TrEMBL
Pfam	Histone	UniProtKB/TrEMBL
PhenoGen	Hist1h2bq	PhenoGen
PRINTS	HISTONEH2B	UniProtKB/TrEMBL
PROSITE	HISTONE_H2B	UniProtKB/TrEMBL
SMART	H2B	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47113	UniProtKB/TrEMBL
UniProt	A0A8I6AGQ8	ENTREZGENE, UniProtKB/TrEMBL
	A6KLP6	ENTREZGENE, UniProtKB/TrEMBL
	A6KNB9	ENTREZGENE
	G3V8B3	ENTREZGENE
	G3V9C7	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	G3V8B3	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-05-23	Hist1h2bq	histone cluster 1 H2B family member Q	Hist1h2bq	histone cluster 1, H2bq	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-17	Hist1h2bq	histone cluster 1, H2bq	Hist1h2bh	histone cluster 1, H2bh	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-07	Hist1h2bh	histone cluster 1, H2bh		histone 1, H2bh	Name updated	1299863	APPROVED
2005-12-06	Hist1h2bh	histone 1, H2bh	Hist1h2bh_predicted	histone 1, H2bh (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Hist1h2bh_predicted	histone 1, H2bh (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar