Advanced Search (OLGA)

Gene: Clybl (citramalyl-CoA lyase) Rattus norvegicus

Analyze

Symbol:

Clybl

Name:

citramalyl-CoA lyase

RGD ID:

1304615

Description:

Predicted to enable (S)-citramalyl-CoA lyase activity; magnesium ion binding activity; and malate synthase activity. Predicted to be involved in positive regulation of cobalamin metabolic process and protein homotrimerization. Predicted to be located in mitochondrion. Orthologous to human CLYBL (citramalyl-CoA lyase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

(3S)-malyl-CoA thioesterase; beta-methylmalate synthase; citramalyl-CoA lyase, mitochondrial; citrate lyase beta like; citrate lyase beta-like; citrate lyase subunit beta-like protein, mitochondrial; LOC306198; malate synthase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CLYBL (citramalyl-CoA lyase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Clybl (citrate lyase beta like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Clybl (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CLYBL (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CLYBL (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Clybl (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CLYBL (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CLYBL (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Clybl (citramalyl-CoA lyase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CLYBL (citramalyl-CoA lyase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Clybl (citrate lyase beta like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	clybl (citrate lyase beta like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C01G10.7	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	clybl	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	105,690,283 - 105,912,347 (+)	NCBI		GRCr8
mRatBN7.2	15	99,283,644 - 99,505,697 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	99,283,650 - 99,505,695 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	103,217,082 - 103,437,931 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	104,309,307 - 104,532,758 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	101,236,548 - 101,460,002 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	108,608,203 - 108,838,222 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	108,608,204 - 108,838,235 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	111,996,327 - 112,224,036 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	107,313,924 - 107,539,458 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	107,403,371 - 107,555,046 (+)	NCBI
Celera	15	98,056,530 - 98,276,073 (+)	NCBI		Celera
Cytogenetic Map	15	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Anal Atresia, Hypospadias, and Penoscrotal Inversion (ISO)

holoprosencephaly (ISO)

holoprosencephaly 5 (ISO)

propionic acidemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

chlordecone (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibric acid (EXP)

cocaine (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

daunorubicin (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

folic acid (ISO)

glyphosate (EXP)

hydralazine (ISO)

indole-3-methanol (EXP)

inulin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

MeIQx (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

phlorizin (ISO)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulforaphane (ISO)

temozolomide (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of cobalamin metabolic process (IEA,ISO)

protein homotrimerization (IEA,ISO,ISS)

regulation of cobalamin metabolic process (IBA,ISO,ISS)

Cellular Component

mitochondrion (IEA)

Molecular Function

(S)-citramalyl-CoA lyase activity (IBA,IEA,ISO,ISS)

hydrolase activity (IEA)

magnesium ion binding (IEA,ISO,ISS)

malate synthase activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18614015	PMID:24334609	PMID:29056341

Genomics

Comparative Map Data

Clybl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	105,690,283 - 105,912,347 (+)	NCBI		GRCr8
mRatBN7.2	15	99,283,644 - 99,505,697 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	99,283,650 - 99,505,695 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	103,217,082 - 103,437,931 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	104,309,307 - 104,532,758 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	101,236,548 - 101,460,002 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	108,608,203 - 108,838,222 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	108,608,204 - 108,838,235 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	111,996,327 - 112,224,036 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	107,313,924 - 107,539,458 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	107,403,371 - 107,555,046 (+)	NCBI
Celera	15	98,056,530 - 98,276,073 (+)	NCBI		Celera
Cytogenetic Map	15	q25	NCBI

CLYBL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	99,606,690 - 99,909,444 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	99,606,669 - 99,909,459 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	100,258,944 - 100,561,698 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	99,056,937 - 99,342,825 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	99,056,936 - 99,342,824	NCBI
Celera	13	81,103,446 - 81,393,885 (+)	NCBI		Celera
Cytogenetic Map	13	q32.3	NCBI
HuRef	13	80,853,642 - 81,143,528 (+)	NCBI		HuRef
CHM1_1	13	100,228,927 - 100,519,376 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	98,817,569 - 99,120,319 (+)	NCBI		T2T-CHM13v2.0

Clybl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	122,408,289 - 122,639,646 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	122,419,116 - 122,639,646 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	122,170,994 - 122,402,234 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	122,181,704 - 122,402,234 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	122,580,916 - 122,801,456 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	121,316,901 - 121,537,408 (+)	NCBI		MGSCv36	mm8
Celera	14	120,744,413 - 120,964,342 (+)	NCBI		Celera
Cytogenetic Map	14	E5	NCBI
cM Map	14	65.86	NCBI

Clybl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	10,814,307 - 11,034,467 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	10,813,161 - 11,016,687 (-)	NCBI	ChiLan1.0	ChiLan1.0

CLYBL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	101,131,296 - 101,426,977 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	99,801,499 - 100,116,460 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	80,774,572 - 81,066,375 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	99,912,758 - 100,198,856 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	99,912,773 - 100,195,417 (+)	Ensembl	panpan1.1		panPan2

CLYBL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	49,608,997 - 49,893,766 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	49,608,358 - 49,871,572 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	49,389,904 - 49,674,862 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	50,050,746 - 50,335,889 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	50,050,775 - 50,315,337 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	49,702,099 - 50,000,006 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	49,735,357 - 50,033,523 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	49,772,072 - 50,070,593 (+)	NCBI		UU_Cfam_GSD_1.0

Clybl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	185,032,471 - 185,285,822 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	10,686,927 - 10,919,702 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	10,666,345 - 10,919,694 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLYBL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	68,507,877 - 68,767,546 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	68,507,828 - 68,768,322 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	75,887,675 - 76,025,089 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CLYBL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	78,258,096 - 78,574,515 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666046	34,754,124 - 35,069,782 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Clybl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624793	11,237,097 - 11,480,113 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624793	11,240,495 - 11,479,386 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Clybl
1189 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	236
Count of miRNA genes:	99
Interacting mature miRNAs:	103
Transcripts:	ENSRNOT00000018918, ENSRNOT00000042049
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731177	Uae26	Urinary albumin excretion QTL 26	2.4	0.025	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	15	67588667	101769107	Rat
1549844	Bss7	Bone structure and strength QTL 7	6.4		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	15	75788062	101769107	Rat
2300326	Plaw1	Placental weight QTL 1	15	0.005	placenta mass (VT:0004257)	placenta wet weight (CMO:0002088)	15	68327165	100062518	Rat
1641889	Colcr6	Colorectal carcinoma resistance QTL 6	2.9	0.0126	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	15	73690518	99794247	Rat
70155	Gcs1	Gastric cancer susceptibility QTL1	3.8		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	15	76306099	101769107	Rat
2317055	Aia10	Adjuvant induced arthritis QTL 10	3.41		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	75788062	101769107	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	58156477	101769107	Rat

Markers in Region

D15Rat28

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	105,753,876 - 105,754,031 (+)	Marker Load Pipeline
mRatBN7.2	15	99,347,219 - 99,347,374 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,680,022 - 108,680,176	NCBI	Rnor6.0
Rnor_5.0	15	112,067,388 - 112,067,542	UniSTS	Rnor5.0
RGSC_v3.4	15	107,378,191 - 107,378,345	UniSTS	RGSC3.4
RGSC_v3.4	15	107,377,866 - 107,378,349	RGD	RGSC3.4
RGSC_v3.1	15	107,393,971 - 107,394,125	RGD
Celera	15	98,119,344 - 98,119,498	UniSTS
RH 3.4 Map	15	708.6	RGD
RH 3.4 Map	15	708.6	UniSTS
RH 2.0 Map	15	611.7	RGD
SHRSP x BN Map	15	66.4899	RGD
FHH x ACI Map	15	74.04	RGD
Cytogenetic Map	15	q25	UniSTS

D15Rat157

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	15	105,890,883 - 105,891,100 (+)	Marker Load Pipeline
mRatBN7.2	15	99,484,233 - 99,484,450 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,816,785 - 108,817,001	NCBI	Rnor6.0
Rnor_5.0	15	112,202,616 - 112,202,832	UniSTS	Rnor5.0
RGSC_v3.4	15	107,516,237 - 107,516,454	RGD	RGSC3.4
RGSC_v3.4	15	107,516,238 - 107,516,454	UniSTS	RGSC3.4
RGSC_v3.1	15	107,532,018 - 107,532,234	RGD
Celera	15	98,254,359 - 98,254,575	UniSTS
RH 3.4 Map	15	713.4	UniSTS
RH 3.4 Map	15	713.4	RGD
RH 2.0 Map	15	616.3	RGD
SHRSP x BN Map	15	65.4398	RGD
Cytogenetic Map	15	q25	UniSTS

AI256068

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,486,998 - 99,487,084 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,819,550 - 108,819,635	NCBI	Rnor6.0
Rnor_5.0	15	112,205,381 - 112,205,466	UniSTS	Rnor5.0
RGSC_v3.4	15	107,519,003 - 107,519,088	UniSTS	RGSC3.4
Celera	15	98,257,123 - 98,257,208	UniSTS
Cytogenetic Map	15	q25	UniSTS

RH143957

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,470,286 - 99,470,427 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,802,847 - 108,802,987	NCBI	Rnor6.0
Rnor_5.0	15	112,188,879 - 112,189,019	UniSTS	Rnor5.0
RGSC_v3.4	15	107,502,201 - 107,502,341	UniSTS	RGSC3.4
Celera	15	98,240,849 - 98,240,989	UniSTS
RH 3.4 Map	15	704.7	UniSTS
Cytogenetic Map	15	q25	UniSTS

BE102058

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,282,592 - 99,282,753 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,607,146 - 108,607,306	NCBI	Rnor6.0
Rnor_5.0	15	111,995,289 - 111,995,449	UniSTS	Rnor5.0
RGSC_v3.4	15	107,312,867 - 107,313,027	UniSTS	RGSC3.4
Celera	15	98,055,473 - 98,055,633	UniSTS
RH 3.4 Map	15	708.6	UniSTS
Cytogenetic Map	15	q25	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM063772	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018918 ⟹ ENSRNOP00000018918

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	99,283,650 - 99,505,695 (+)	Ensembl
Rnor_6.0 Ensembl	15	108,608,204 - 108,838,235 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107907 ⟹ ENSRNOP00000094930

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	99,410,866 - 99,505,695 (+)	Ensembl

RefSeq Acc Id:

NM_001100685 ⟹ NP_001094155

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,690,308 - 105,912,347 (+)	NCBI
mRatBN7.2	15	99,283,650 - 99,505,697 (+)	NCBI
Rnor_6.0	15	108,608,203 - 108,838,222 (+)	NCBI
Rnor_5.0	15	111,996,327 - 112,224,036 (+)	NCBI
RGSC_v3.4	15	107,313,924 - 107,539,458 (+)	RGD
Celera	15	98,056,530 - 98,276,073 (+)	RGD

Sequence:

show sequence

GCGGGCCACGTCGGGAAGATGGCGCTGTGTGTGCTGCAGAACGCGGTTCGCGGAGCGGCGGCGC
TGCCCAGGCTAAAGGCATCCCTCGTGGCCAGTGTCTGCAGGCCTGGGTACAGCTCCTTGTCCAA
TCACAAGTATGTCCCTCGGAGGGCAGTGCTCTATGTGCCTGGGAATGACGAAAAGAAAATAAGG
AAGATCCCATCTTTGAAAGTAGATTGTGCTGTGCTGGACTGCGAGGACGGTGTCGCGGAAAACA
AAAAGAACGAAGCTCGATTGAGAATAGCAAAAACTCTTGAAGACTTTGACCTGGGCACAACGGA
AAAGTGTGTGAGAATCAACTCAGTGTCTAGTGGTCTGGCTGAAGCCGACCTGGAGACATTTCTA
CAGGCCAGAGTTCTTCCTTCTAGTCTGATGCTACCAAAGGTAGAAGGTCCTGAAGAAATCCAGT
GGTTTTCAGACAAATTTTCACTCCACTTAAAAGGCCGAAAGCTTGAACAACCAATGAATTTAAT
CCCCTTTGTGGAGACTGCAATGGGTTTGCTCAATTTTAAGGCAGTGTGTGAAGAAACACTAAAG
ATTGGACCTCAAGTGGGTCTTTTCCTAGACGCAGTCGTTTTTGGAGGAGAAGATTTTCGAGCCA
GCATAGGTGCAACAAGCAACAAGGACACCCAAGACATCCTCTATGCCCGACAGAAGATTGTCGT
CACGGCAAAGGCCTTTGGCCTACAAGCCATAGATCTTGTATACATCGACTTCCGGGATGAAGAT
GGACTTCTCAGACAGTCTAGAGAAGCAGCCGCCATGGGCTTCACTGGTAAACAGGTGATCCACC
CTAACCAGATTGCCGTGGTACAGGAACAGTTTACTCCAACCCCGGAAAAAATTCGGTGGGCTGA
AGAGCTGATTGCTGCCTTCAAAGAACACCAGCAGTTGGGAAAGGGAGCCTTTACTTTCCAAGGA
AGTATGATCGACATGCCATTACTGAAGCAGGCCCAGAACATTGTTACGCTTGCCACATCCATCA
AGGAAAAATGATCTGTTAAATGAAGCCCTTCTCAGGCGGGCTGAATGGATACCGTGGGTTTCTT
AAAGACAAACCACAGTACCCAGGGCAGCTTGCTAGCACGCCGGATCGGGACCTCATCTCACGTT
AGTCACAACGCCCCCTCCCCTTGCATCTTACTGACCCGATATTCTAAAAATAAACGTTCTTCCC
TTGGAATCTAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063274361 ⟹ XP_063130431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,690,283 - 105,912,347 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001094155	(Get FASTA)	NCBI Sequence Viewer
	XP_063130431	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88243	(Get FASTA)	NCBI Sequence Viewer
	EDM02576	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018918.5
	ENSRNOP00000094930.1
	ENSRNOP00060011394
GenBank Protein	Q5I0K3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001094155 ⟸ NM_001100685
- Peptide Label:	precursor
- UniProtKB:	Q5I0K3 (UniProtKB/Swiss-Prot), A0A8I6B1P6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALCVLQNAVRGAAALPRLKASLVASVCRPGYSSLSNHKYVPRRAVLYVPGNDEKKIRKIPSLK VDCAVLDCEDGVAENKKNEARLRIAKTLEDFDLGTTEKCVRINSVSSGLAEADLETFLQARVLP SSLMLPKVEGPEEIQWFSDKFSLHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKIGPQVG LFLDAVVFGGEDFRASIGATSNKDTQDILYARQKIVVTAKAFGLQAIDLVYIDFRDEDGLLRQS REAAAMGFTGKQVIHPNQIAVVQEQFTPTPEKIRWAEELIAAFKEHQQLGKGAFTFQGSMIDMP LLKQAQNIVTLATSIKEK hide sequence

Ensembl Acc Id:

ENSRNOP00000018918 ⟸ ENSRNOT00000018918

Ensembl Acc Id:

ENSRNOP00000094930 ⟸ ENSRNOT00000107907

RefSeq Acc Id:	XP_063130431 ⟸ XM_063274361
- Peptide Label:	isoform X1

Protein Domains

HpcH/HpaI aldolase/citrate lyase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0K3-F1-model_v2	AlphaFold	Q5I0K3	1-338	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699883

Promoter ID:

EPDNEW_R10407

Type:

multiple initiation site

Name:

Clybl_1

Description:

citrate lyase beta like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	108,608,210 - 108,608,270	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304615	AgrOrtholog
BioCyc Gene	G2FUF-12357	BioCyc
Ensembl Genes	ENSRNOG00000014075	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00060008800	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018918.8	UniProtKB/Swiss-Prot
	ENSRNOT00000107907.1	UniProtKB/TrEMBL
	ENSRNOT00060014742	UniProtKB/Swiss-Prot
Gene3D-CATH	3.20.20.60	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7366315	IMAGE-MGC_LOAD
InterPro	Aldolase/citrate-lyase_domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Citramalyl-CoA_lyase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Citrate_lyase_beta/mcl1/mcl2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pyrv/PenolPyrv_Kinase-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pyrv_Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:306198	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109029	IMAGE-MGC_LOAD
NCBI Gene	306198	ENTREZGENE
PANTHER	CITRAMALYL-COA LYASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11105	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HpcH_HpaI	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Clybl	PhenoGen
PIRSF	Cit_lyase_B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014075	RatGTEx
	ENSRNOG00060008800	RatGTEx
Superfamily-SCOP	SSF51621	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6B1P6	ENTREZGENE, UniProtKB/TrEMBL
	A6HUL3_RAT	UniProtKB/TrEMBL
	CLYBL_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-04-28	Clybl	citramalyl-CoA lyase	Clybl	citrate lyase beta like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Clybl	citrate lyase beta like	Clybl_predicted	citrate lyase beta like (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Clybl_predicted	citrate lyase beta like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar