Cog6 (component of oligomeric golgi complex 6)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cog6 (component of oligomeric golgi complex 6) Rattus norvegicus

Analyze

Symbol:

Cog6

Name:

component of oligomeric golgi complex 6

RGD ID:

1303283

Description:

Predicted to be involved in Golgi organization; glycosylation; and retrograde transport, vesicle recycling within Golgi. Predicted to be located in Golgi membrane. Predicted to be part of Golgi transport complex. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation type IIl. Orthologous to human COG6 (component of oligomeric golgi complex 6); INTERACTS WITH 2,6-dinitrotoluene; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

COG complex subunit 6; conserved oligomeric Golgi complex subunit 6; MGC94990

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COG6 (component of oligomeric golgi complex 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cog6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cog6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COG6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COG6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cog6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COG6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COG6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cog6 (component of oligomeric golgi complex 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	COG6 (component of oligomeric golgi complex 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cog6 (component of oligomeric golgi complex 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cog6 (component of oligomeric golgi complex 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1968	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	COG6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cogc-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	137,062,127 - 137,099,176 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	137,061,346 - 137,099,190 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	143,639,424 - 143,676,204 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	141,751,508 - 141,788,288 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	136,383,282 - 136,420,047 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	142,197,566 - 142,235,054 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	142,196,754 - 142,235,066 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	161,882,713 - 161,921,014 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	142,767,258 - 142,804,731 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	142,717,222 - 142,754,694 (-)	NCBI
Celera	2	131,560,563 - 131,597,609 (-)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital disorder of glycosylation (ISO)

congenital disorder of glycosylation type IIl (ISO)

genetic disease (ISO)

hypohidrosis (ISO)

intellectual disability (ISO)

Shaheen Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

acetamide (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

genistein (EXP)

hydrogen peroxide (ISO)

ketamine (EXP)

methyl methanesulfonate (ISO)

nefazodone (EXP)

paracetamol (ISO)

potassium chromate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

testosterone (ISO)

thapsigargin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

glycosylation (ISO)

glycosylation (ISS)

Golgi organization (ISO)

intra-Golgi vesicle-mediated transport (IBA,IEA)

protein transport (IEA)

retrograde transport, vesicle recycling within Golgi (ISO)

Cellular Component

Golgi membrane (IEA)

Golgi transport complex (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15047703	PMID:20605848

Genomics

Comparative Map Data

Cog6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	137,062,127 - 137,099,176 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	137,061,346 - 137,099,190 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	143,639,424 - 143,676,204 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	141,751,508 - 141,788,288 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	136,383,282 - 136,420,047 (-)	NCBI	Rnor_WKY
Rnor_6.0	2	142,197,566 - 142,235,054 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	142,196,754 - 142,235,066 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	161,882,713 - 161,921,014 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	142,767,258 - 142,804,731 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	142,717,222 - 142,754,694 (-)	NCBI
Celera	2	131,560,563 - 131,597,609 (-)	NCBI		Celera
Cytogenetic Map	2	q26	NCBI

COG6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	39,655,627 - 39,791,666 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	13	39,655,627 - 39,791,665 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	40,229,764 - 40,365,803 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	39,127,814 - 39,224,633 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	39,127,813 - 39,224,632	NCBI
Celera	13	21,282,474 - 21,418,517 (+)	NCBI		Celera
Cytogenetic Map	13	q14.11	NCBI
HuRef	13	21,028,744 - 21,165,223 (+)	NCBI		HuRef
CHM1_1	13	40,197,304 - 40,333,343 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	38,874,034 - 39,010,137 (+)	NCBI		T2T-CHM13v2.0

Cog6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	52,889,544 - 52,924,644 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	52,889,296 - 52,924,658 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	52,982,123 - 53,017,223 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	52,981,875 - 53,017,237 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	52,786,045 - 52,821,145 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	53,070,095 - 53,105,130 (-)	NCBI		MGSCv36	mm8
Celera	3	52,710,466 - 52,745,600 (-)	NCBI		Celera
Cytogenetic Map	3	C	NCBI

Cog6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955431	6,637,327 - 6,703,828 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955431	6,641,116 - 6,703,797 (-)	NCBI	ChiLan1.0	ChiLan1.0

COG6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	13	39,459,424 - 39,556,002 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	39,459,424 - 39,591,666 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	13	20,872,151 - 20,973,658 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

COG6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	1,428,277 - 1,524,734 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	1,331,966 - 1,524,747 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	1,471,940 - 1,621,602 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	1,472,981 - 1,622,702 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	1,472,081 - 1,622,745 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	1,375,174 - 1,524,816 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	1,368,146 - 1,517,792 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	1,434,939 - 1,584,610 (-)	NCBI		UU_Cfam_GSD_1.0

Cog6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	162,511,267 - 162,585,473 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936565	5,996,270 - 6,069,426 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936565	5,996,031 - 6,069,517 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COG6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	14,576,214 - 14,649,795 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	14,576,194 - 14,737,836 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	14,710,709 - 14,979,188 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

COG6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	18,034,004 - 18,170,050 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	18,034,066 - 18,130,060 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666057	26,108,592 - 26,245,376 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cog6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624748	444,784 - 520,804 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cog6
131 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	30
Count of miRNA genes:	28
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000018385
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	112103657	148076632	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1354594	Despr10	Despair related QTL 10		0.00000249	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	114654253	159654253	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	143657569	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	143657569	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
5135226	Leukc2	Leukocyte quantity QTL 2			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	2	118111229	149559726	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	118111229	157142209	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	118189491	163189491	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	127447387	143657569	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	129164097	152195315	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat

Markers in Region

RH134230

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	137,061,411 - 137,061,618 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	142,196,851 - 142,197,057	NCBI	Rnor6.0
Rnor_5.0	2	161,882,783 - 161,882,989	UniSTS	Rnor5.0
RGSC_v3.4	2	142,766,543 - 142,766,749	UniSTS	RGSC3.4
Celera	2	131,559,848 - 131,560,054	UniSTS
RH 3.4 Map	2	850.8	UniSTS
Cytogenetic Map	2	q26	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	42	52	36	19	36	8	11	74	35	41	11	8
Low		1	5	5		5
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225755	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000018385 ⟹ ENSRNOP00000018385

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	137,061,346 - 137,099,190 (-)	Ensembl
Rnor_6.0 Ensembl	2	142,196,754 - 142,235,066 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098369 ⟹ ENSRNOP00000079046

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	137,062,129 - 137,099,176 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105660 ⟹ ENSRNOP00000084043

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	137,062,129 - 137,099,176 (-)	Ensembl

RefSeq Acc Id:

NM_001004262 ⟹ NP_001004262

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	137,062,127 - 137,099,176 (-)	NCBI
Rnor_6.0	2	142,197,566 - 142,235,054 (-)	NCBI
Rnor_5.0	2	161,882,713 - 161,921,014 (-)	NCBI
RGSC_v3.4	2	142,767,258 - 142,804,731 (-)	RGD
Celera	2	131,560,563 - 131,597,609 (-)	RGD

Sequence:

show sequence

CGATGGCTGACACCAGCGGGGAGGTGGCGGCGGTCCCCGCCTCCGGGGCCGCCAATGGCCTCAG
CAATGGGGCTGGCGCGACCCCAGCGCAGCCCAACAACCCGCTGTCGCGCAAGCTGCACAAGATC
CTGGAAACGCGGCTTGAAAATGACAAGGAGATGTTGGAAGCTCTCAAGGCCCTCTCAGCCTTTT
TTGTTGAAAATAGTTTGCGGACTCGACGGAATCTACGCGGTGATATTGAACGTAGAAGCTTAGC
CATCAATGAGGAATTTGTAAGCATTTTCAAAGATGTAAAGGAGGAACTCGAAAGCATCAATGAA
GACGTACAAGCAATGAGCAGCTGCTGTCAGGACATGACAAGCCGCTTACAGGCAGCAAAGGAAC
AGACTCAAGATTTAATAGTAAAGACCACTAAGCTTCAAGCGGAAAACCAAAGACTAGAAATTAG
AGCACAAGTTGCAGATGCCTTTTTATCCAAGTTCCAGTTGACTTCTGATGAAATGACTCTCCTC
CGAGGTACAAGAGGAGGCCCCGTTACTGAGGACTTTTTCAAGGCTTTGGGAAGAGTGAAACAAA
TTCATAATGACGTCAAAGTTCTTTTGAGAACCAACCAGCAGACGGCAGGTTTGGAGATTATGGA
ACAGATGGCCTTGCTTCAAGAAACTGCTTATGAAAGACTTTACCGGTGGGCTCAAAGCGAGTGC
AGAGCACTGACTCAGGAGTCCTGTGATGTGTCTGCGGTGTTAACTCAGGCCATGGAAGCCCTGC
AGGACAGGCCTGTCTTGTACAAGTATACCTTAGATGAATTTGGAACGGCCAGGCGAAGCACTGT
GGTTCGTGGGTTTATTGATGCTCTTACAAGAGGAGGGCCAGGAGGTACACCTAGACCCATTGAA
ATGCACTCCCATGACCCGCTGAGGTATGTGGGAGACATGCTGGCCTGGCTCCATCAAGCTACTG
CCTCTGAGAAGGAACATCTGGAAGCTCTCTTAAAGCATGTAACTGCACAGGGTGTTAAAGAAAA
TATTCAAGAAGTTGTTGGGCATATCACCGAGGGTGTGTGTCGGCCTCTAAAGGTTCGAATTGAA
CAAGTAATACTTGCTGAACCTGGGGCAGTGTTATTATATAAAATTTCTAACCTCCTCAAGTTTT
ACCACCATACCATCAGTGGCATTGTTGGAAATAGTGCAGCTACTCTACTGACAACAATTGAAGA
AATGCACTTGCTAAGCAAAAAAATATTCTTCAGTAGCTTGAGTCTCCATGCGAATAAACTGATG
GACAAGATCGAGCTCCCACCACCTGACCTCGGACCCAGTTCTGCCCTGAGTCAGACCCTCACTT
TGCTGCGGGACGTTCTGGCCTCACATGATTCTTCAGTGGTCCCCTTGGATGCTCGGCAAGCTGA
CTTTGTGCAGGTTTTGTCATGTGTCCTGGATCCTCTCCTCCAGATGTGCACAGTGTCAGCCAGC
AATTTAGGCACCGCTGACATGGCCACGTTCATGGTCAATTCACTGTACATGATGAAGACGACAC
TGGCTCTGTTTGAATTCACAGACAGGCGCCTGGAAATGCTTCAGTTTCAGATCGAAGCCCATCT
GGACACTCTTATCAATGAGCAAGCCTCTTACGTTTTAACTAGAGTGGGCTTGAGTTACATCTAC
AACACGATACAGCAGCATAGGCCTGATCAGGGCTCCTTAGCCAGTATGCCCAACCTAGATTCTG
TGGCGCTGAAGGCTGCAATGGCTCAGTTCGACCGCTACCTCTCAGCCCCAGATCACCTGCTGAT
GCCACAGCTGAACTCCCTCCTCAGTGCCACCGTGAAGGAGCAGATTATAAAGCAGTCTACGGAG
CTCGTCTGCAGAGCCTACGGGGAGGTGCATGCAGCCGTGATGAATCCAGTCAACGCGTACAAAG
ACCCGGAGAGCATCCTTCACAGGTCACCCGAGCAGGTGAAGACGCTGCTCTCTTGATGTTGATG
GCGTTTGCAGAGTATTGCTGCCTGGCAACAGCACCAAGGGTGGTTTGGGCTTTTAATCTATGAG
TCTTTACCTTGAAGATTGAGAGTTAATAGTTTTCCTTGTATGGGGTTGTAGGTCAATTTCTCCC
ATTCTCAGCTAACTTGGAGGTAAATCAATATTGACTTGAAAAAAAAAAAAAAAAAAAAAAAAAA
A

hide sequence

RefSeq Acc Id:

XM_039102262 ⟹ XP_038958190

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	137,062,154 - 137,091,777 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004262	(Get FASTA)	NCBI Sequence Viewer
	XP_038958190	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79442	(Get FASTA)	NCBI Sequence Viewer
	EDM14961	(Get FASTA)	NCBI Sequence Viewer
	EDM14962	(Get FASTA)	NCBI Sequence Viewer
	EDM14963	(Get FASTA)	NCBI Sequence Viewer
	EDM14964	(Get FASTA)	NCBI Sequence Viewer
	Q68FP9	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001004262 ⟸ NM_001004262

- UniProtKB:

Q68FP9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MADTSGEVAAVPASGAANGLSNGAGATPAQPNNPLSRKLHKILETRLENDKEMLEALKALSAFF
VENSLRTRRNLRGDIERRSLAINEEFVSIFKDVKEELESINEDVQAMSSCCQDMTSRLQAAKEQ
TQDLIVKTTKLQAENQRLEIRAQVADAFLSKFQLTSDEMTLLRGTRGGPVTEDFFKALGRVKQI
HNDVKVLLRTNQQTAGLEIMEQMALLQETAYERLYRWAQSECRALTQESCDVSAVLTQAMEALQ
DRPVLYKYTLDEFGTARRSTVVRGFIDALTRGGPGGTPRPIEMHSHDPLRYVGDMLAWLHQATA
SEKEHLEALLKHVTAQGVKENIQEVVGHITEGVCRPLKVRIEQVILAEPGAVLLYKISNLLKFY
HHTISGIVGNSAATLLTTIEEMHLLSKKIFFSSLSLHANKLMDKIELPPPDLGPSSALSQTLTL
LRDVLASHDSSVVPLDARQADFVQVLSCVLDPLLQMCTVSASNLGTADMATFMVNSLYMMKTTL
ALFEFTDRRLEMLQFQIEAHLDTLINEQASYVLTRVGLSYIYNTIQQHRPDQGSLASMPNLDSV
ALKAAMAQFDRYLSAPDHLLMPQLNSLLSATVKEQIIKQSTELVCRAYGEVHAAVMNPVNAYKD
PESILHRSPEQVKTLLS

hide sequence

RefSeq Acc Id:

ENSRNOP00000018385 ⟸ ENSRNOT00000018385

RefSeq Acc Id:	XP_038958190 ⟸ XM_039102262
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000079046 ⟸ ENSRNOT00000098369

RefSeq Acc Id:

ENSRNOP00000084043 ⟸ ENSRNOT00000105660

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FP9-F1-model_v2	AlphaFold	Q68FP9	1-657	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691321

Promoter ID:

EPDNEW_R1846

Type:

multiple initiation site

Name:

Cog6_1

Description:

component of oligomeric golgi complex 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	142,235,064 - 142,235,124	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303283	AgrOrtholog
BioCyc Gene	G2FUF-53103	BioCyc
Ensembl Genes	ENSRNOG00000013660	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000018385.4	UniProtKB/TrEMBL
	ENSRNOP00000079046	ENTREZGENE
	ENSRNOP00000079046.1	UniProtKB/TrEMBL
	ENSRNOP00000084043.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018385.6	UniProtKB/TrEMBL
	ENSRNOT00000098369	ENTREZGENE
	ENSRNOT00000098369.1	UniProtKB/TrEMBL
	ENSRNOT00000105660.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7115484	IMAGE-MGC_LOAD
InterPro	COG6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:310411	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94990	IMAGE-MGC_LOAD
NCBI Gene	310411	ENTREZGENE
PANTHER	CONSERVED OLIGOMERIC GOLGI COMPLEX SUBUNIT 6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR21506	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	COG6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cog6	PhenoGen
SMART	COG6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZM11_RAT	UniProtKB/TrEMBL
	A0A8I6G9T5_RAT	UniProtKB/TrEMBL
	A0A8L2QA73_RAT	UniProtKB/TrEMBL
	COG6_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Cog6	component of oligomeric golgi complex 6			Symbol and Name status set to approved	1299863	APPROVED
2005-09-30	Cog6				Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM