Advanced Search (OLGA)

Gene: Bpi (bactericidal/permeability-increasing protein) Rattus norvegicus

Analyze

Symbol:

Bpi

Name:

bactericidal/permeability-increasing protein

RGD ID:

1303179

Description:

Enables lipopolysaccharide binding activity. Involved in defense response to bacterium and immune response. Predicted to be located in cytoplasmic stress granule. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in Crohn's disease. Orthologous to human BPI (bactericidal permeability increasing protein); INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; bisphenol A; cefaloridine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

bactericidal permeability-increasing protein; BPI fold containing family D, member 1; Bpifd1; MGC94477

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Candidate Gene For:

Eau4

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	167,329,513 - 167,356,217 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	167,329,530 - 167,356,396 (+)	Ensembl				GRCr8
mRatBN7.2	3	146,909,626 - 146,936,487 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	146,909,629 - 146,936,221 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	150,734,952 - 150,761,530 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	159,234,289 - 159,260,817 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	156,975,825 - 157,002,320 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	154,741,627 - 154,768,584 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	154,741,631 - 154,768,640 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	160,837,585 - 160,864,610 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	148,970,965 - 148,998,795 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	145,610,965 - 145,637,569 (+)	NCBI		Celera
RGSC_v3.1	3	148,876,873 - 148,904,703 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Crohn's disease (ISO)

focal epilepsy (ISO)

severe acute respiratory syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium sulfate (ISO)

cefaloridine (EXP)

cyclophosphamide (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

paracetamol (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

tamibarotene (ISO)

tebuconazole (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to bacterium (IDA,IEA)

defense response to Gram-negative bacterium (IBA,IEA)

immune response (IDA)

immune system process (IEA)

innate immune response (IBA,IEA)

lipopolysaccharide-mediated signaling pathway (IBA)

negative regulation of interleukin-6 production (IBA,ISO)

negative regulation of interleukin-8 production (IBA,ISO)

negative regulation of macrophage activation (IBA,ISO)

negative regulation of tumor necrosis factor production (IBA,ISO)

Cellular Component

cytoplasm (ISO)

cytoplasmic stress granule (ISO)

extracellular region (IEA)

extracellular space (IBA,IEA)

membrane (IEA)

Molecular Function

lipid binding (IEA,TAS)

lipopolysaccharide binding (IBA,IDA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Effect of recombinant bactericidal/permeability-increasing protein on endotoxin translocation and lipopolysaccharide-binding protein/CD14 expression in rats after thermal injury.	Fang WH, etal., Crit Care Med 2001 Jul;29(7):1452-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	A polymorphism of the bactericidal/permeability increasing protein (BPI) gene is associated with Crohn's disease.	Klein W, etal., J Clin Gastroenterol. 2005 Apr;39(4):282-3.
4.	Elucidating the molecular physiopathology of acute respiratory distress syndrome in severe acute respiratory syndrome patients.	Kong SL, etal., Virus Res. 2009 Nov;145(2):260-9. Epub 2009 Jul 25.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Presence of bactericidal/permeability-increasing protein in human and rat skin.	Takahashi M, etal., Exp Dermatol 2004 Jan;13(1):55-60.

Additional References at PubMed

PMID:1937776	PMID:8409400	PMID:14739326	PMID:15590754	PMID:19056867	PMID:23376485

Genomics

Comparative Map Data

Bpi
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	167,329,513 - 167,356,217 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	167,329,530 - 167,356,396 (+)	Ensembl				GRCr8
mRatBN7.2	3	146,909,626 - 146,936,487 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	146,909,629 - 146,936,221 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	150,734,952 - 150,761,530 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	159,234,289 - 159,260,817 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	156,975,825 - 157,002,320 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	154,741,627 - 154,768,584 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	154,741,631 - 154,768,640 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	160,837,585 - 160,864,610 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	148,970,965 - 148,998,795 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	145,610,965 - 145,637,569 (+)	NCBI		Celera
RGSC_v3.1	3	148,876,873 - 148,904,703 (+)	NCBI
Cytogenetic Map	3	q42	NCBI

BPI
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	38,304,156 - 38,337,505 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	38,260,141 - 38,337,505 (+)	Ensembl			hg38	GRCh38
GRCh37	20	36,932,558 - 36,965,907 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	36,365,966 - 36,399,319 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	20	36,365,998 - 36,399,319	NCBI
Celera	20	33,641,353 - 33,674,701 (+)	NCBI		Celera
Cytogenetic Map	20	q11.23	NCBI
HuRef	20	33,669,787 - 33,677,356 (+)	NCBI		HuRef
HuRef	20	33,682,342 - 33,700,820 (+)	NCBI		HuRef
CHM1_1	20	36,836,236 - 36,869,681 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	40,030,315 - 40,063,822 (+)	NCBI		T2T-CHM13v2.0

Bpi
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	158,099,983 - 158,126,453 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	158,100,014 - 158,126,451 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	158,258,063 - 158,284,533 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	158,258,094 - 158,284,531 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	158,083,977 - 158,110,267 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	157,949,682 - 157,975,972 (+)	NCBI		MGSCv36	mm8
Celera	2	164,202,890 - 164,229,087 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	78.72	NCBI

Bpi
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955445	18,391,215 - 18,427,980 (-)	Ensembl
ChiLan1.0	NW_004955445	18,393,854 - 18,433,948 (-)	NCBI	ChiLan1.0	ChiLan1.0

BPI
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	44,029,197 - 44,061,897 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	44,022,295 - 44,054,995 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	34,633,243 - 34,661,171 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	35,739,700 - 35,771,910 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	35,739,700 - 35,771,910 (+)	Ensembl			panPan2	panpan1.1

BPI
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	26,772,410 - 26,800,763 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	26,767,746 - 26,800,762 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	26,418,210 - 26,446,528 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	27,468,496 - 27,496,799 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	27,470,021 - 27,496,805 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	26,742,847 - 26,771,163 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	26,850,759 - 26,879,003 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	27,339,168 - 27,367,492 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Bpi
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	175,679,861 - 175,706,205 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	3,043,578 - 3,069,689 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	3,043,520 - 3,069,680 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BPI
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	41,344,939 - 41,392,100 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	17	41,344,878 - 41,392,103 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	46,783,441 - 46,831,210 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BPI
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	25,416,154 - 25,450,474 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	25,416,463 - 25,449,958 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666050	74,256,072 - 74,290,275 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bpi
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	1,339,603 - 1,360,097 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624842	1,339,309 - 1,363,265 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Bpi
240 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	167
Count of miRNA genes:	119
Interacting mature miRNAs:	129
Transcripts:	ENSRNOT00000039994
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12879876	Bw182	Body weight QTL 182		0.003	body mass (VT:0001259)	body weight (CMO:0000012)	3	145925360	166177555	Rat
2301411	Bp320	Blood pressure QTL 320		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145925360	166177555	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1300113	Bp176	Blood pressure QTL 176	3.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	145956084	157309487	Rat
12879872	Cm97	Cardiac mass QTL 97		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	145925360	166177555	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
12879873	Cm96	Cardiac mass QTL 96		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	145925360	166177555	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
12879874	Cm98	Cardiac mass QTL 98		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	145925360	166177555	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
12879875	Kidm64	Kidney mass QTL 64		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	145925360	166177555	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
8552791	Vie2	Viral induced encephalitis QTL 2	4.1		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	3	145956084	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
2317883	Alcrsp26	Alcohol response QTL 26	1.8	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	3	145526770	169034231	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1598854	Memor10	Memory QTL 10	2		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	3	145956084	161299569	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
12879871	Am7	Aortic mass QTL 7		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	145925360	166177555	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
16	4	18	30	30	44	18	53	18	3	191	82	9	19	73	62	26

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000039994 ⟹ ENSRNOP00000049523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	167,329,544 - 167,356,135 (+)	Ensembl
mRatBN7.2 Ensembl	3	146,909,629 - 146,936,221 (+)	Ensembl
Rnor_6.0 Ensembl	3	154,741,631 - 154,768,640 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113213 ⟹ ENSRNOP00000085180

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	167,329,543 - 167,353,878 (+)	Ensembl
mRatBN7.2 Ensembl	3	146,909,629 - 146,933,968 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000140998 ⟹ ENSRNOP00000098690

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	167,329,530 - 167,356,396 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000170063 ⟹ ENSRNOP00000107568

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	167,329,530 - 167,356,396 (+)	Ensembl

RefSeq Acc Id:

NM_001004079 ⟹ NP_001004079

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	167,329,552 - 167,356,131 (+)	NCBI
mRatBN7.2	3	146,909,638 - 146,936,222 (+)	NCBI
Rnor_6.0	3	154,741,637 - 154,768,540 (+)	NCBI
Rnor_5.0	3	160,837,585 - 160,864,610 (-)	NCBI
RGSC_v3.4	3	148,970,965 - 148,998,795 (+)	RGD
Celera	3	145,610,965 - 145,637,569 (+)	RGD

Sequence:

show sequence

CAGACCTCTAGGCTCCACTGGGGCAGCCCCTGGACTGGTCCCCAACGTTGATGGGGAACCGCAG
CTGCCCTCCCCCTCCCGCCCCCACGGTTGCCTTCCTCCTTCCTCTTTCTACTACTGCCCTGCCC
TTCCCCAGAAGGCTTTTTTATAGGTCTCAAGTTCCCATCCGAGGCCTTGAGGTTTGGGGCTGCC
CTGGAGGACATGGCCTGGGGCCCTGACAACGTGCGGAAATGGTCAAGCCTGGCACTGCTGGCCA
TCGTGGGCACAGCTTTGACAGCGGCCACCGACCCTGGCTTCGTGGCCAGAATCTCCCAGAAGGG
TCTGGACTTCGTGTGCCAGGAGAGTATGGTTGAGTTGCAGAAGGAGCTCCTAGCCATCAGCATT
CCTGACTTCTCTGGAGACTTTAAGATAAAGCACCTGGGAAAGGGTACCTATGAATTCTACAGCA
TGGCCGTGGAAGGATTTCATATTCCTGATCCCCAGATCAAGCTGCTACCCAGTGATGGCCTCCA
GCTGTCCATCACCAGTGCCAGCATCAAGATAAGTGGAAGATGGAAATATAGGAAGAACATCCTC
AAAGCCAGCGGCAATTTTCAGCTGAGCATTCAGGGTGTCTCTATCATCGCTGACCTGATCCTGG
GCAATGACCCCTCAGGTCGCATCACCATCACCTGTTCTACTTGCGACAGTCACATCAACAGCGT
CCGCATCAAAGTCTCTGGCAGCATGCTGGGGTGGCTGATCCAACTGTTCCACAGGAAAATTGAG
ACTTCCTTGAAAAAGACCATTTACAAAAAGATCTGCAAGATCGTGAGAAACTCCGTGTCCGCCA
AGCTTCAGCCTTATGTGAAGACTCTTCCAGTGGTAGCCAAAGTGGATGATATAACCTCGATTGA
CTACAGTCTGCTGGCTCCTCCGATGACCACGGACAAGTTCCTGGAGGGGCAGCTAAGGGGGGAG
TTTTTCTGGCGGGGACACCACGGCCCATTTCCCGCTGTCCCACCAGTAATGAATATTTTGCCCA
ACAATAACTACATGGTATGCATGGGCATCTCTGACTACTTCTTCAACACTGCAGAGTTTGCGTA
CCAAGAGTCTGAAACCTTGAAAATAACCCTGAGGGACCAATTGTTAGCAAAGGATGCCAGATAC
CACCTGAACACTGACTTCCTTAAGACCTTTCTGCCCGAGGTGGCCAAGAAGTTCCCCAGCATGG
GGTTGCAGCTACTGATCTCAGCGCCCTTGTTTGCACACCTGAACATACAGCCCTCAGGCCTTTC
GCTCAGTCCTAACCTGGAGACCCGGGCCTTTGTGGTCCTCCCCAACTCCTCCCTGATCCCTCTC
TTCCTGCTTGGCATGAAAACAAATGCCTCTCTGGAAGTGAATGCTATGAAAAACAGGCTTATTG
GCGAGATGAAGCTAGGCAGGCTGTTGCTGGAACTGAAGCAATCCAACTTTGGCTCCTTTAAGGT
GGAGTTACTGGAGGATGTCATAAACTACCTCATGTCCACAATGGTGCTGCCCAAGATCAACGAG
AAGCTGCGTCGAGGCTTTCCTCTCCCTTTGCCTGCCGGGATTCAGCTCATCAACTCGATTCTTT
ACTCCTCCCAGAATTTCCTGTTGCTTGAGGCGGATTTACACCGGACCTGAGATCACCTCAGACC
CTGAGCCAGGAAGCTCTGCAGCTGCTTCCAAGGGGCCATCACACTCACCGGCTGTCCTGCTCAA
GAATCCTTTAGTCTTTGACCCTGACCTGCAGCCCCTGCTTGCTTCCCCGTGCTCAGCTCTAGAA
ATAACCCAAGCCACTGGAAGTTGAGCACCGGAAAGCGAGAGGTCTGTGTACCGGGGCTCCGGGC
CTCTTTCAGAGCAGCCCCTCCAGCACCGGCATTTCTGCGGCAGCTGTGACATTATTTTGGACTT
TACAAAAACACCCCTTTTCTCCCCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039104626 ⟹ XP_038960554

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	167,329,513 - 167,356,217 (+)	NCBI
mRatBN7.2	3	146,909,626 - 146,935,954 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004079	(Get FASTA)	NCBI Sequence Viewer
	XP_038960554	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79318	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098690
	ENSRNOP00000107568
GenBank Protein	Q6AXU0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001004079 ⟸ NM_001004079
- Peptide Label:	precursor
- UniProtKB:	Q6AXU0 (UniProtKB/Swiss-Prot), A0A8L2QQX2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAWGPDNVRKWSSLALLAIVGTALTAATDPGFVARISQKGLDFVCQESMVELQKELLAISIPDF SGDFKIKHLGKGTYEFYSMAVEGFHIPDPQIKLLPSDGLQLSITSASIKISGRWKYRKNILKAS GNFQLSIQGVSIIADLILGNDPSGRITITCSTCDSHINSVRIKVSGSMLGWLIQLFHRKIETSL KKTIYKKICKIVRNSVSAKLQPYVKTLPVVAKVDDITSIDYSLLAPPMTTDKFLEGQLRGEFFW RGHHGPFPAVPPVMNILPNNNYMVCMGISDYFFNTAEFAYQESETLKITLRDQLLAKDARYHLN TDFLKTFLPEVAKKFPSMGLQLLISAPLFAHLNIQPSGLSLSPNLETRAFVVLPNSSLIPLFLL GMKTNASLEVNAMKNRLIGEMKLGRLLLELKQSNFGSFKVELLEDVINYLMSTMVLPKINEKLR RGFPLPLPAGIQLINSILYSSQNFLLLEADLHRT hide sequence

Ensembl Acc Id:

ENSRNOP00000049523 ⟸ ENSRNOT00000039994

RefSeq Acc Id:	XP_038960554 ⟸ XM_039104626
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A2Q9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085180 ⟸ ENSRNOT00000113213

Ensembl Acc Id:

ENSRNOP00000098690 ⟸ ENSRNOT00000140998

Ensembl Acc Id:

ENSRNOP00000107568 ⟸ ENSRNOT00000170063

Protein Domains

Lipid-binding serum glycoprotein C-terminal Lipid-binding serum glycoprotein N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXU0-F1-model_v2	AlphaFold	Q6AXU0	1-482	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692619

Promoter ID:

EPDNEW_R3143

Type:

initiation region

Name:

Bpi_1

Description:

bactericidal/permeability-increasing protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	154,741,646 - 154,741,706	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303179	AgrOrtholog
BioCyc Gene	G2FUF-47035	BioCyc
Ensembl Genes	ENSRNOG00000034195	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000140998	ENTREZGENE
	ENSRNOT00000170063	ENTREZGENE
Gene3D-CATH	Bactericidal permeability-increasing protein, domain 1	UniProtKB/Swiss-Prot
	Bactericidal permeability-increasing protein, domain 2	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7135061	IMAGE-MGC_LOAD
InterPro	Bactericidal_perm-incr_a/b_dom	UniProtKB/Swiss-Prot
	BPI/LBP	UniProtKB/Swiss-Prot
	BPI/LBP/Plunc	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_C	UniProtKB/Swiss-Prot
	Lipid-bd_serum_glycop_N	UniProtKB/Swiss-Prot
KEGG Report	rno:296321	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94477	IMAGE-MGC_LOAD
NCBI Gene	296321	ENTREZGENE
PANTHER	PTHR10504	UniProtKB/Swiss-Prot
	PTHR10504:SF84	UniProtKB/Swiss-Prot
Pfam	LBP_BPI_CETP	UniProtKB/Swiss-Prot
	LBP_BPI_CETP_C	UniProtKB/Swiss-Prot
PhenoGen	Bpi	PhenoGen
PIRSF	Lipid_binding_protein	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000034195	RatGTEx
SMART	BPI1	UniProtKB/Swiss-Prot
	BPI2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF55394	UniProtKB/Swiss-Prot
UniProt	A0A8I6A2Q9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QQX2	ENTREZGENE, UniProtKB/TrEMBL
	BPI_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Bpi	bactericidal/permeability-increasing protein			Symbol and Name status set to approved	1299863	APPROVED
2005-07-14	Bpi	bactericidal/permeability-increasing protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar