Vkorc1 (vitamin K epoxide reductase complex, subunit 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Vkorc1 (vitamin K epoxide reductase complex, subunit 1) Rattus norvegicus

Analyze

Symbol:

Vkorc1

Name:

vitamin K epoxide reductase complex, subunit 1

RGD ID:

1303107

Description:

Enables vitamin-K-epoxide reductase (warfarin-insensitive) activity. Contributes to vitamin-K-epoxide reductase (warfarin-sensitive) activity. Involved in several processes, including regulation of blood coagulation; response to antibiotic; and response to organonitrogen compound. Located in intracellular membrane-bounded organelle. Used to study warfarin sensitivity. Human ortholog(s) of this gene implicated in combined deficiency of vitamin K-dependent clotting factors 2 and warfarin resistance. Orthologous to human VKORC1 (vitamin K epoxide reductase complex subunit 1); PARTICIPATES IN acenocoumarol pharmacodynamics pathway; alteplase pharmacodynamics pathway; aminocaproic acid pharmacodynamics pathway; INTERACTS WITH (+)-schisandrin B; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

phylloquinone epoxide reductase; vitamin K epoxide reductase complex subunit 1; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K1 epoxide reductase (warfarin-sensitive); Warfarin resistance

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	182,502,491 - 182,505,012 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,500,844 - 182,505,008 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	190,853,032 - 190,855,553 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	198,039,126 - 198,041,647 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	190,709,541 - 190,712,063 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	199,338,785 - 199,341,306 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,337,138 - 199,341,302 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	206,361,380 - 206,363,901 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	187,176,745 - 187,179,266 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	187,326,627 - 187,329,147 (-)	NCBI
Celera	1	180,153,292 - 180,155,813 (-)	NCBI		Celera
Cytogenetic Map	1	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aortic Calcification (IAGP)

Aortic Rupture (ISO)

blood coagulation disease (ISO)

branched-chain keto acid dehydrogenase kinase deficiency (ISO)

combined deficiency of vitamin K-dependent clotting factors 2 (ISO)

Coronary Disease (ISO)

Coumarin Sensitivity (ISO)

Hemorrhage (ISO)

Stroke (ISO)

thrombosis (ISO)

vascular disease (ISO)

warfarin resistance (ISO)

warfarin sensitivity (IAGP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxycoumarin (ISO)

7-Hydroxywarfarin (ISO)

acenocoumarol (ISO)

acetamide (EXP)

acetylsalicylic acid (ISO)

acrylamide (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (ISO)

Bromadiolone (EXP,ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

Chlorophacinone (EXP)

chloropicrin (ISO)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Coumachlor (ISO)

coumarin (ISO)

coumarins (ISO)

Coumatetralyl (EXP,ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dehydroacetic acid (EXP)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dicoumarol (ISO)

Difenacoum (EXP,ISO)

Difethialone (EXP)

dioxygen (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

Enterolactone (ISO)

etoposide (ISO)

fipronil (EXP)

fluindione (ISO)

folic acid (ISO)

GW 4064 (ISO)

indometacin (ISO)

ivermectin (ISO)

L-methionine (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

paracetamol (ISO)

phenindione (ISO)

phenprocoumon (ISO)

phylloquinone (ISO)

pyrimidifen (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

selenium atom (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

valproic acid (ISO)

vitamin E (ISO)

vitamin K epoxide (EXP,ISO)

warfarin (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blood coagulation (IBA,ISO)

blood coagulation (ISO)

blood coagulation (ISO,ISS)

bone development (ISO,ISS)

peptidyl-glutamic acid carboxylation (IBA,ISO,ISS)

positive regulation of coagulation (ISO)

regulation of blood coagulation (IMP)

response to antibiotic (IDA)

response to organic cyclic compound (IDA)

response to organonitrogen compound (IDA)

vitamin K metabolic process (IBA,IEA,ISO,ISS)

xenobiotic metabolic process (ISO)

Cellular Component

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IEA,ISO)

intracellular membrane-bounded organelle (IDA)

Molecular Function

protein binding (ISO)

quinone binding (IEA)

vitamin-K-epoxide reductase (warfarin-insensitive) activity (IDA,ISO)

vitamin-K-epoxide reductase (warfarin-sensitive) activity (IDA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acenocoumarol pharmacodynamics pathway (ISO)

alteplase pharmacodynamics pathway (ISO)

aminocaproic acid pharmacodynamics pathway (ISO)

anistreplase pharmacodynamics pathway (ISO)

aprotinin pharmacodynamics pathway (ISO)

argatroban pharmacodynamics pathway (ISO)

bivalirudin pharmacodynamics pathway (ISO)

dicoumarol pharmacodynamics pathway (ISO)

enoxaparin pharmacodynamics pathway (ISO)

fondaparinux pharmacodynamics pathway (ISO)

heparin pharmacodynamics pathway (ISO)

phenindione pharmacodynamics pathway (ISO)

reteplase pharmacodynamics pathway (ISO)

tranexamic acid pharmacodynamics pathway (ISO)

vitamin K cycle pathway (ISO)

vitamin K metabolic pathway (ISO)

warfarin pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Characterization and purification of the vitamin K1 2,3 epoxide reductases system from rat liver.	Begent LA, etal., J Pharm Pharmacol. 2001 Apr;53(4):481-6.
2.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
3.	Structural Modeling Insights into Human VKORC1 Phenotypes.	Czogalla KJ, etal., Nutrients. 2015 Aug 14;7(8):6837-51. doi: 10.3390/nu7085313.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	A cardiovascular phenotype in warfarin-resistant Vkorc1 mutant rats.	Kohn MH, etal., Artery Res. 2008 Nov;2(4):138-147.
6.	Depression of liver microsomal vitamin K epoxide reductase activity associated with antibiotic-induced coagulopathy.	Matsubara T, etal., Biochem Pharmacol. 1989 Aug 15;38(16):2693-701.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Comprehensive gene review and curation	RGD comprehensive gene curation
14.	Mutations in VKORC1 cause warfarin resistance and multiple coagulation factor deficiency type 2.	Rost S, etal., Nature 2004 Feb 5;427(6974):537-41.
15.	Effect of N-ethylmaleimide on beef and rat liver vitamin K1 epoxide reductase.	Silverman RB and Nandi DL, J Enzyme Inhib. 1990;3(4):289-94.
16.	Structural and functional insights into enzymes of the vitamin K cycle.	Tie JK and Stafford DW, J Thromb Haemost. 2016 Feb;14(2):236-47. doi: 10.1111/jth.13217. Epub 2016 Jan 29.
17.	The inhibitory effect of calumenin on the vitamin K-dependent gamma-carboxylation system. Characterization of the system in normal and warfarin-resistant rats.	Wajih N, etal., J Biol Chem. 2004 Jun 11;279(24):25276-83. Epub 2004 Apr 9.
18.	Engineering of a recombinant vitamin K-dependent gamma-carboxylation system with enhanced gamma-carboxyglutamic acid forming capacity: evidence for a functional CXXC redox center in the system.	Wajih N, etal., J Biol Chem. 2005 Mar 18;280(11):10540-7. Epub 2005 Jan 7.
19.	Species comparison of vitamin K1 2,3-epoxide reductase activity in vitro: kinetics and warfarin inhibition.	Wilson CR, etal., Toxicology. 2003 Aug 1;189(3):191-8.

Additional References at PubMed

PMID:12477932	PMID:15879509	PMID:16270630	PMID:19200363	PMID:19492146	PMID:20978134	PMID:21127708	PMID:23018795	PMID:23918929	PMID:23928358	PMID:24611351	PMID:27846632
PMID:29155484	PMID:30214074	PMID:31484376	PMID:32687688	PMID:33771253	PMID:35296766	PMID:35430058	PMID:35970209	PMID:36309944

Genomics

Comparative Map Data

Vkorc1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	182,502,491 - 182,505,012 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	182,500,844 - 182,505,008 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	190,853,032 - 190,855,553 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	1	198,039,126 - 198,041,647 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	1	190,709,541 - 190,712,063 (-)	NCBI	Rnor_WKY
Rnor_6.0	1	199,338,785 - 199,341,306 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	199,337,138 - 199,341,302 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	206,361,380 - 206,363,901 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	187,176,745 - 187,179,266 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	187,326,627 - 187,329,147 (-)	NCBI
Celera	1	180,153,292 - 180,155,813 (-)	NCBI		Celera
Cytogenetic Map	1	q37	NCBI

VKORC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	31,090,854 - 31,094,797 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	16	31,090,842 - 31,095,980 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	31,102,175 - 31,106,118 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	31,009,676 - 31,013,777 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	29,191,224 - 29,195,328 (+)	NCBI		Celera
Cytogenetic Map	16	p11.2	NCBI
HuRef	16	28,663,874 - 28,667,978 (-)	NCBI		HuRef
CHM1_1	16	32,419,476 - 32,423,596 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	31,478,282 - 31,482,234 (-)	NCBI		T2T-CHM13v2.0

Vkorc1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	127,492,235 - 127,494,833 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	127,485,399 - 127,494,626 (-)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	7	127,492,235 - 127,494,789 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	127,893,063 - 127,895,658 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	127,886,227 - 127,895,454 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	7	127,893,063 - 127,895,617 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	135,036,577 - 135,039,131 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	127,684,211 - 127,686,765 (-)	NCBI		MGSCv36	mm8
Celera	7	127,728,262 - 127,730,816 (-)	NCBI		Celera
Cytogenetic Map	7	F3	NCBI
cM Map	7	69.81	NCBI

Vkorc1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955493	7,928,516 - 7,931,265 (-)	NCBI	ChiLan1.0	ChiLan1.0

VKORC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	16	31,459,556 - 31,464,617 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	31,459,560 - 31,464,897 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	16	23,871,756 - 23,876,599 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

VKORC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	17,140,565 - 17,142,621 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	17,140,633 - 17,142,547 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	18,715,931 - 18,717,978 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	17,271,459 - 17,273,505 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	17,271,517 - 17,273,431 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	17,071,856 - 17,073,902 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	16,990,716 - 16,992,762 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	17,303,101 - 17,305,147 (+)	NCBI		UU_Cfam_GSD_1.0

Vkorc1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	125,361,540 - 125,363,993 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936501	13,459,022 - 13,462,174 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936501	13,459,400 - 13,461,864 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VKORC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	17,386,245 - 17,389,905 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	17,386,230 - 17,389,162 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	17,483,272 - 17,485,908 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VKORC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	27,778,553 - 27,782,639 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	27,776,416 - 27,782,640 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	1,685,255 - 1,689,345 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vkorc1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624782	14,141,545 - 14,144,177 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624782	14,141,545 - 14,144,181 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Vkorc1
43 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	164
Count of miRNA genes:	119
Interacting mature miRNAs:	130
Transcripts:	ENSRNOT00000073596
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642722	214537671	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383635	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164747424	209747424	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
2312558	Glom17	Glomerulus QTL 17	3.9	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	166532971	191278129	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169112897	197261052	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383635	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
2325725	Eae31	Experimental allergic encephalomyelitis QTL 31			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	178810256	188377506	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	181746937	196383635	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat

Markers in Region

RH128112

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	182,502,683 - 182,502,877 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	199,338,978 - 199,339,171	NCBI	Rnor6.0
Rnor_5.0	1	206,361,573 - 206,361,766	UniSTS	Rnor5.0
RGSC_v3.4	1	187,176,938 - 187,177,131	UniSTS	RGSC3.4
Celera	1	180,153,485 - 180,153,678	UniSTS
Cytogenetic Map	1	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	25	48	41	3	41	1	2	56	35	32	11	1
Low	1	18	9		16		7	9	18		9		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_203335	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW253787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY423047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB314647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218167	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LC218168	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430820	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430821	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430825	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MH430826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW148998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000073596 ⟹ ENSRNOP00000063977

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	182,500,844 - 182,505,008 (-)	Ensembl
Rnor_6.0 Ensembl	1	199,337,138 - 199,341,302 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101446 ⟹ ENSRNOP00000087618

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	182,500,844 - 182,504,595 (-)	Ensembl

RefSeq Acc Id:

NM_203335 ⟹ NP_976080

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	182,502,491 - 182,505,012 (-)	NCBI
Rnor_6.0	1	199,338,785 - 199,341,306 (-)	NCBI
Rnor_5.0	1	206,361,380 - 206,363,901 (-)	NCBI
RGSC_v3.4	1	187,176,745 - 187,179,266 (-)	RGD
Celera	1	180,153,292 - 180,155,813 (-)	RGD

Sequence:

show sequence

GTGTCTGCGCTGTACTGTCGACATGGGCACCACCTGGAGGAGCCCTGGACGTTTGCGGCTTGCA
CTATGCCTCGCTGGCCTAGCCCTCTCACTGTACGCACTGCACGTGAAGGCGGCGCGCGCCCGCA
ATGAGGATTACCGCGCGCTCTGCGACGTGGGCACGGCCATCAGCTGTTCCCGCGTCTTCTCCTC
TCGGTGGGGCCGGGGCTTTGGGCTGGTGGAGCATGTGTTAGGAGCTGACAGCATCCTCAACCAA
TCCAACAGCATATTTGGTTGCATGTTCTACACCATACAGCTGTTGTTAGGTTGCTTGAGGGGAC
GTTGGGCCTCTATCCTACTGATCCTGAGTTCCCTGGTGTCTGTCGCTGGTTCTCTGTACCTGGC
CTGGATCCTGTTCTTTGTCCTGTATGATTTCTGCATTGTTTGCATCACCACCTATGCCATCAAT
GCGGGCCTGATGTTGCTTAGCTTCCAGAAGGTGCCAGAACACAAGGTCAAAAAGCCCTGAGGTC
CCACCTCATGCCAGGCTGACATGACTTGCTTTGCCTTAGCACATGAGCCTTGCCCAAGTGTATC
GTGTGTGGGTCCCTAAAAGGCCCTATCACCCTCATTCAAACACCCCTCTATAACCACACACAGA
AAAATGACCAAATGTGCCTCTAGGTTCTGTCCCCATTGGGCTGCTTTCTGCTATTGGTCAAAGA
GAAGGATTTTGAACAATAAATTTTTCTATGTTGGTCAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_976080	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66413	(Get FASTA)	NCBI Sequence Viewer
	AAR82917	(Get FASTA)	NCBI Sequence Viewer
	BAX00317	(Get FASTA)	NCBI Sequence Viewer
	BAX00318	(Get FASTA)	NCBI Sequence Viewer
	BAX00319	(Get FASTA)	NCBI Sequence Viewer
	BAX00320	(Get FASTA)	NCBI Sequence Viewer
	BAX00321	(Get FASTA)	NCBI Sequence Viewer
	BAX00322	(Get FASTA)	NCBI Sequence Viewer
	BAX00323	(Get FASTA)	NCBI Sequence Viewer
	BAX00324	(Get FASTA)	NCBI Sequence Viewer
	BAX00325	(Get FASTA)	NCBI Sequence Viewer
	BAX00326	(Get FASTA)	NCBI Sequence Viewer
	BAX00327	(Get FASTA)	NCBI Sequence Viewer
	BAX00328	(Get FASTA)	NCBI Sequence Viewer
	BAX00329	(Get FASTA)	NCBI Sequence Viewer
	BAX00330	(Get FASTA)	NCBI Sequence Viewer
	BAX00331	(Get FASTA)	NCBI Sequence Viewer
	BAX00332	(Get FASTA)	NCBI Sequence Viewer
	BAX00333	(Get FASTA)	NCBI Sequence Viewer
	EDM17218	(Get FASTA)	NCBI Sequence Viewer
	EDM17219	(Get FASTA)	NCBI Sequence Viewer
	Q6TEK4	(Get FASTA)	NCBI Sequence Viewer
	QBB72906	(Get FASTA)	NCBI Sequence Viewer
	QBB72907	(Get FASTA)	NCBI Sequence Viewer
	QBB72908	(Get FASTA)	NCBI Sequence Viewer
	QBB72909	(Get FASTA)	NCBI Sequence Viewer
	QBB72910	(Get FASTA)	NCBI Sequence Viewer
	QBB72911	(Get FASTA)	NCBI Sequence Viewer
	QBB72912	(Get FASTA)	NCBI Sequence Viewer
	UQJ72509	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_976080 ⟸ NM_203335
- Peptide Label:	precursor
- UniProtKB:	Q6TEK4 (UniProtKB/Swiss-Prot), B2GUU6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGTTWRSPGRLRLALCLAGLALSLYALHVKAARARNEDYRALCDVGTAISCSRVFSSRWGRGFG LVEHVLGADSILNQSNSIFGCMFYTIQLLLGCLRGRWASILLILSSLVSVAGSLYLAWILFFVL YDFCIVCITTYAINAGLMLLSFQKVPEHKVKKP hide sequence

RefSeq Acc Id:

ENSRNOP00000063977 ⟸ ENSRNOT00000073596

RefSeq Acc Id:

ENSRNOP00000087618 ⟸ ENSRNOT00000101446

Protein Domains

Vitamin K epoxide reductase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6TEK4-F1-model_v2	AlphaFold	Q6TEK4	1-161	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690444

Promoter ID:

EPDNEW_R969

Type:

initiation region

Name:

Vkorc1_1

Description:

vitamin K epoxide reductase complex, subunit 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	199,341,313 - 199,341,373	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303107	AgrOrtholog
BioCyc Gene	G2FUF-57331	BioCyc
BioCyc Pathway	PWY-7999 [vitamin K-epoxide cycle]	BioCyc
Ensembl Genes	ENSRNOG00000050828	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000063977	ENTREZGENE
	ENSRNOP00000063977.1	UniProtKB/Swiss-Prot
	ENSRNOP00000087618.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000073596	ENTREZGENE
	ENSRNOT00000073596.3	UniProtKB/Swiss-Prot
	ENSRNOT00000101446.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1440.130	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9100951	IMAGE-MGC_LOAD
InterPro	VKOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VKOR_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VKORC1/VKORC1L1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:309004	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:187297	IMAGE-MGC_LOAD
NCBI Gene	309004	ENTREZGENE
PANTHER	PTHR14519	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	VITAMIN K EPOXIDE REDUCTASE COMPLEX SUBUNIT 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	VKOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	VKORC1	RGD
PhenoGen	Vkorc1	PhenoGen
SMART	VKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A1S7IVG9_RAT	UniProtKB/TrEMBL
	A0A1S7IVH4_RAT	UniProtKB/TrEMBL
	A0A1S7IVH6_RAT	UniProtKB/TrEMBL
	A0A1S7IVH8_RAT	UniProtKB/TrEMBL
	A0A1S7IVH9_RAT	UniProtKB/TrEMBL
	A0A1S7IVI4_RAT	UniProtKB/TrEMBL
	A0A1S7IVI8_RAT	UniProtKB/TrEMBL
	A0A1S7IVJ5_RAT	UniProtKB/TrEMBL
	A0A411HQX2_RAT	UniProtKB/TrEMBL
	A0A411HQZ0_RAT	UniProtKB/TrEMBL
	A0A411HR06_RAT	UniProtKB/TrEMBL
	A0A411HR20_RAT	UniProtKB/TrEMBL
	A0A411HR25_RAT	UniProtKB/TrEMBL
	A0A8I6A3H3_RAT	UniProtKB/TrEMBL
	B2GUU6	ENTREZGENE, UniProtKB/TrEMBL
	Q6TEK4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Vkorc1	vitamin K epoxide reductase complex, subunit 1	Vkorc1	vitamin K epoxide reductase complex, subunit 1	Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Vkorc1	vitamin K epoxide reductase complex, subunit 1	Rw	Warfarin resistance	Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Rw	Warfarin resistance			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	mutations of the human homolog are detected in individuals with combined deficiency of Vitamin K-dependent clotting factors type 2 (VKCFD2) and warfarin resistance (WR)	1303972
gene_mutations_overexpression	Tyr139Cys mutation is associated with warfarin resistance in the Rw strain	1303972

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB