Fcar (Fc alpha receptor) - Rat Genome Database

Name: Fcar
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Fcar (Fc alpha receptor) Rattus norvegicus

Analyze

Symbol:

Fcar

Name:

Fc alpha receptor (Ensembl:Fc fragment of IgA receptor)

RGD ID:

1303082

Description:

Predicted to enable IgA binding activity and IgA receptor activity. Predicted to be involved in several processes, including cellular response to cytokine stimulus; cellular response to lipopolysaccharide; and positive regulation of neutrophil apoptotic process. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in IgA glomerulonephritis; granulomatosis with polyangiitis; and renal fibrosis. Orthologous to human FCAR (Fc alpha receptor); PARTICIPATES IN phagocytosis pathway; Staphylococcus aureus infection pathway; INTERACTS WITH amphetamine; benzo[a]pyrene; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Cd89; Fc fragment of IgA receptor; Fc fragment of IgA, receptor for; IgA Fc receptor; immunoglobulin alpha Fc receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FCAR (Fc alpha receptor)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Pan paniscus (bonobo/pygmy chimpanzee):	FCAR (Fc alpha receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FCAR (Fc fragment of IgA receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FCAR (Fc alpha receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103235282 (immunoglobulin alpha Fc receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FCAR (Fc alpha receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	78,669,119 - 78,703,223 (-)	NCBI		GRCr8
mRatBN7.2	1	69,626,458 - 69,660,558 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	1	74,985,346 - 75,019,443 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	83,549,652 - 83,583,756 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	76,707,876 - 76,741,999 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	73,230,392 - 73,263,462 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	73,230,390 - 73,264,302 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	75,285,444 - 75,318,514 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	68,976,542 - 69,022,651 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	69,054,652 - 69,100,762 (-)	NCBI
Celera	1	67,474,424 - 67,508,554 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

granulomatosis with polyangiitis (ISO)

IgA glomerulonephritis (ISO)

renal fibrosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

Dibutyl phosphate (ISO)

dioxygen (EXP)

fipronil (ISO)

folic acid (ISO)

protein kinase inhibitor (ISO)

silicon dioxide (EXP)

sulforaphane (ISO)

triphenyl phosphate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to granulocyte macrophage colony-stimulating factor stimulus (ISO)

cellular response to interferon-alpha (ISO)

cellular response to interleukin-6 (ISO)

cellular response to lipopolysaccharide (ISO)

cellular response to tumor necrosis factor (ISO)

cellular response to type II interferon (ISO)

Fc receptor signaling pathway (ISO)

immune response-regulating signaling pathway (IBA)

neutrophil activation (ISO)

neutrophil mediated immunity (ISO)

positive regulation of neutrophil apoptotic process (ISO)

Cellular Component

plasma membrane (IBA,ISO)

Molecular Function

IgA binding (ISO)

IgA receptor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

phagocytosis pathway (IEA)

Staphylococcus aureus infection pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Transglutaminase is essential for IgA nephropathy development acting through IgA receptors.	Berthelot L, etal., J Exp Med. 2012 Apr 9;209(4):793-806. doi: 10.1084/jem.20112005. Epub 2012 Mar 26.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Inhibitory ITAM signaling by Fc alpha RI-FcR gamma chain controls multiple activating responses and prevents renal inflammation.	Kanamaru Y, etal., J Immunol. 2008 Feb 15;180(4):2669-78.
4.	IgA and IgG antineutrophil cytoplasmic antibody engagement of Fc receptor genetic variants influences granulomatosis with polyangiitis.	Kelley JM, etal., Proc Natl Acad Sci U S A. 2011 Dec 20;108(51):20736-41. doi: 10.1073/pnas.1109227109. Epub 2011 Dec 6.
5.	Identification of the rat IgA Fc receptor encoded in the leukocyte receptor complex.	Maruoka T, etal., Immunogenetics 2004 Jan;55(10):712-6. Epub 2003 Nov 26.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Negative regulation of inflammatory responses by immunoglobulin A receptor (FcalphaRI) inhibits the development of Toll-like receptor-9 signalling-accelerated glomerulonephritis.	Watanabe T, etal., Clin Exp Immunol. 2011 Nov;166(2):235-50. doi: 10.1111/j.1365-2249.2011.04452.x.

Additional References at PubMed

PMID:25339672

Genomics

Comparative Map Data

Fcar
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	78,669,119 - 78,703,223 (-)	NCBI		GRCr8
mRatBN7.2	1	69,626,458 - 69,660,558 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	1	74,985,346 - 75,019,443 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	83,549,652 - 83,583,756 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	76,707,876 - 76,741,999 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	73,230,392 - 73,263,462 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	73,230,390 - 73,264,302 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	75,285,444 - 75,318,514 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	68,976,542 - 69,022,651 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	69,054,652 - 69,100,762 (-)	NCBI
Celera	1	67,474,424 - 67,508,554 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

FCAR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	54,874,235 - 54,891,420 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	54,874,235 - 54,891,420 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	55,385,691 - 55,402,786 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	60,077,361 - 60,093,651 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	60,077,360 - 60,092,249	NCBI
Celera	19	52,426,154 - 52,442,442 (+)	NCBI		Celera
Cytogenetic Map	19	q13.42	NCBI
HuRef	19	51,708,188 - 51,724,488 (+)	NCBI		HuRef
CHM1_1	19	55,379,113 - 55,395,493 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	57,968,550 - 57,985,728 (+)	NCBI		T2T-CHM13v2.0

FCAR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	61,012,313 - 61,030,983 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	62,741,639 - 62,762,425 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	51,919,345 - 51,935,340 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	60,614,350 - 60,630,614 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	60,614,405 - 60,630,480 (+)	Ensembl	panpan1.1		panPan2

FCAR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	102,709,675 - 102,720,680 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	102,773,321 - 102,784,329 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	103,376,217 - 103,387,212 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	1	102,995,899 - 103,006,891 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	102,700,005 - 102,711,007 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	103,472,232 - 103,483,230 (-)	NCBI		UU_Cfam_GSD_1.0

FCAR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	59,074,996 - 59,084,788 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	59,074,979 - 59,084,798 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	53,998,651 - 54,008,044 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103235282
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	47,498,332 - 47,512,629 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	47,498,497 - 47,514,417 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	32,031 - 48,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Fcar
106 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	311
Count of miRNA genes:	201
Interacting mature miRNAs:	229
Transcripts:	ENSRNOT00000029621
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	12	21	38	46	16	24	16	5	75	45	10	7	23	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_201992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB109766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB109767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB109768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025080 ⟹ ENSRNOP00000025080

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	69,616,601 - 69,622,570 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000029621 ⟹ ENSRNOP00000028910

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	69,616,601 - 69,660,558 (-)	Ensembl
Rnor_6.0 Ensembl	1	73,230,392 - 73,264,302 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000087826 ⟹ ENSRNOP00000069202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	73,230,390 - 73,263,466 (-)	Ensembl

RefSeq Acc Id:

NM_201992 ⟹ NP_973721

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	78,669,119 - 78,703,223 (-)	NCBI
mRatBN7.2	1	69,626,458 - 69,660,558 (-)	NCBI
Rnor_6.0	1	73,230,392 - 73,263,462 (-)	NCBI
Rnor_5.0	1	75,285,444 - 75,318,514 (+)	NCBI
RGSC_v3.4	1	68,976,542 - 69,022,651 (-)	RGD
Celera	1	67,474,424 - 67,508,554 (+)	RGD

Sequence:

show sequence

AAGAAGCTAACTGGTCTGAGGCCATATCAGCATCATGGCCCCTCAGGACAACACCTTCCTATGT
CTTGTGATCTGCCTGGGTCAGACAATTTGGGCACAAGAAGATTTTCCCATTCCCATCATATCCA
CTGCAACAAATCCTATGGTTTCCTGGAATGAGTCTGTGAGGATCCTGTGCAGGGGAACACCGGA
AGCCTTCCTGTATCAGTTGTCCCTGATGAAAAACTCCACACAAACAGTTATAGAGAAGAAACTA
GGATTTCAAAAAGAGGCTGAATTCATTATCAACCACATGAATTCAACACTGGCAGGATGTTATC
AGTGTCAGTATAGGAAGAAGAACCACTGGTCAGAGCAGAGTAAACCCCTGAAGCTAGTGGTGAC
AGGCTTGTATGACAAACCTGTCCTCTCCACAGATCAAAGCCTTGTGTTGTTACCAGGAGAGAAC
GTTTCCTTCAAGTGTAGTTCAGCCCACAACCTGTTCAACAGATTTTCACTGGCCAAAGAGGGAG
AAGCTTCCTTGCCATTGCACCAACATAAGGAGTCTCAAGGCAACTTCCACCTGGGTCCTGTGAA
CGCTGACTTCATTGGAAAATACAGATGCTACGGCTGGCACAACAACAGCCCCTATGTGTGGTCA
GCCCCCAGTGATGCCCTGGAGCTCATTGTCTCAGTTACATCTCTAGACTCCGAGAAGCATGATT
ACGTGATGGAGAATTCAATCCGGATAGGTATGGCTGGGCTGGTCCTTGTCATACTCTTGGTGAT
AGTATCTGAAGATTGGTACAGCCACAGGATCTCACACAAGGAATGCTGTCAGGAACGGGCTGCA
AAGAGATGGAGCAAACAGGGTGTCAGACCTAGTGACTGTAGATAAATACTGGGAACCACAGGTT
CTTGCAAACAGGAAAAGCCATTAAAAGCTTGGATCTATCTGAAGGCTACAAGGTTTGAGCGAAA
AGTGTCCACCACAGGCTCATGTGTTTGAATACTTACTCTCCAGCAGAGGATGCTGTTTGGGGAG
ATGTATAGAACCTTCAAGTTGTGATATATATAGTTCACTGGAGGCTACTCTTTGAAGGTTATAG
TCACTTCAGGTTCCCATCTAGATGTCTACCACCATACACTCCCATGGAACTGCTTCTATGATAT
TCCTTTCTGCCATGATAGAATACTCCCTCTGAAAAGATGAGCCAGAATCAGTCTCGTCTTTCTT
CCTGTCAGGTGGCAAAAAAATTAACCAATACACAGAGACATCAGATGGTATGGTCATGGATTGA
TCTGGTGCTATATCTTCTCTATTAGTTAGCACACAACTTTGGCGTTTTAATACATTTTTCTTTT
ATTTGTGAGCTTATAATATAATTACACAATTTCATTCTTCCCTTGGATAGGTTTTGTCAACTTG
AAACAAACTAGGAGCATCTGGGGAGAGGGTACTTTAATTGAAAAAATACTTCAGTCAGCTTGCC
CTTCAAGCAAGCCTGTGGGGTATTTTCTTGATTAACGGTTGCTGTGGGAGCAGGGAGGCCAGCT
CACTGTGGGTGGCATCTCCCTGGGCAGGTGTTTCTGGGTTTTAGGAAAAGCAAACTGAGCAAGC
CATGGAGAGCAAGCCAGTAAGCAGCATTCTTTCGTGGACTCTGCCTTCAGCTCCTGCCTCCATG
CGTATGCTTTCACTTTCTACCCTGGCTTCCCCTGATGATGGAATGTAACCTGTAAACCAAATAA
ATCTTTTCCTCCAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_973721	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAD08446	(Get FASTA)	NCBI Sequence Viewer
	BAD08447	(Get FASTA)	NCBI Sequence Viewer
	BAD08448	(Get FASTA)	NCBI Sequence Viewer
	EDL75825	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028910.5

RefSeq Acc Id:	NP_973721 ⟸ NM_201992
- Peptide Label:	precursor
- UniProtKB:	A6KNK6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPQDNTFLCLVICLGQTIWAQEDFPIPIISTATNPMVSWNESVRILCRGTPEAFLYQLSLMKN STQTVIEKKLGFQKEAEFIINHMNSTLAGCYQCQYRKKNHWSEQSKPLKLVVTGLYDKPVLSTD QSLVLLPGENVSFKCSSAHNLFNRFSLAKEGEASLPLHQHKESQGNFHLGPVNADFIGKYRCYG WHNNSPYVWSAPSDALELIVSVTSLDSEKHDYVMENSIRIGMAGLVLVILLVIVSEDWYSHRIS HKECCQERAAKRWSKQGVRPSDCR hide sequence

Ensembl Acc Id:

ENSRNOP00000069202 ⟸ ENSRNOT00000087826

Ensembl Acc Id:

ENSRNOP00000028910 ⟸ ENSRNOT00000029621

Ensembl Acc Id:

ENSRNOP00000025080 ⟸ ENSRNOT00000025080

Protein Domains

Immunoglobulin subtype Immunoglobulin-like beta-sandwich

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZRL6-F1-model_v2	AlphaFold	D3ZRL6	1-280	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303082	AgrOrtholog
BioCyc Gene	G2FUF-60830	BioCyc
Ensembl Genes	ENSRNOG00000027855	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029621.7	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig-like_Receptors_ImmuneReg	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Immunoglobulin	UniProtKB/TrEMBL
NCBI Gene	365183	ENTREZGENE
PANTHER	IMMUNOGLOBULIN ALPHA FC RECEPTOR	UniProtKB/TrEMBL
	MHC CLASS I NK CELL RECEPTOR	UniProtKB/TrEMBL
	NATURAL CYTOTOXICITY TRIGGERING RECEPTOR 1	UniProtKB/TrEMBL
Pfam	Ig_2	UniProtKB/TrEMBL
	PF00047	UniProtKB/TrEMBL
PhenoGen	Fcar	PhenoGen
RatGTEx	ENSRNOG00000027855	RatGTEx
SMART	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	A6KNK6	ENTREZGENE, UniProtKB/TrEMBL
	D3ZRL6_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-11-11	Fcar	Fc alpha receptor	Fcar	Fc fragment of IgA receptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-04-29	Fcar	Fc fragment of IgA receptor	Fcar	Fc fragment of IgA, receptor for	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-04-01	Fcar	Fc fragment of IgA, receptor for	Fcar	IgA Fc receptor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-14	Fcar	IgA Fc receptor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)