Rpl18a (ribosomal protein L18A) - Rat Genome Database

Name: Rpl18a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rpl18a (ribosomal protein L18A) Rattus norvegicus

Analyze

Symbol:

Rpl18a

Name:

ribosomal protein L18A

RGD ID:

1302976

Description:

Predicted to be a structural constituent of ribosome. Involved in response to antineoplastic agent. Located in ribosome. Part of cytosolic large ribosomal subunit. Is active in postsynaptic density. Biomarker of alcohol use disorder. Orthologous to human RPL18A (ribosomal protein L18a); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

60S ribosomal protein L18a; large ribosomal subunit protein eL20; MGC72957; similar to 60S ribosomal protein L18a

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL18A (ribosomal protein L18a)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpl18a (ribosomal protein L18A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl18a (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL18A (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL18A (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl18a (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL18A (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL18A (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl18a (ribosomal protein L18a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPL18A (ribosomal protein L18a)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Rpl18a (ribosomal protein L18A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpl18a (ribosomal protein L18a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL20A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL20B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL18A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpl18a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	18,542,555 - 18,544,578 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,542,566 - 18,545,546 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,584,772 - 18,586,795 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,717,450 - 19,719,473 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,637,713 - 18,639,736 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,293,277 - 20,295,283 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,293,229 - 20,295,294 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,150,821 - 20,152,827 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,042,063 - 19,044,069 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,042,060 - 19,044,067 (+)	NCBI
Celera	16	18,735,212 - 18,737,218 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol use disorder (IEP)

genetic disease (ISO)

Megalencephaly-Polymicrogyria-Polydactyly-Hydrocephalus Syndrome 1 (ISO)

severe combined immunodeficiency, autosomal recessive, T cell-negative, B cell-negative, NK cell-positive (ISO)

Severe Combined Immunodeficiency, Autosomal Recessive, T Cell-Negative, B Cell-Positive, NK Cell-Negative (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

chloropicrin (ISO)

chlorpyrifos (ISO)

coumarin (ISO)

Cuprizon (ISO)

cylindrospermopsin (ISO)

diarsenic trioxide (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

glafenine (EXP)

haloperidol (ISO)

hydralazine (ISO)

ivermectin (ISO)

Monobutylphthalate (ISO)

nefazodone (EXP)

nimesulide (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

potassium chromate (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

stigmasterol (ISO)

streptozocin (EXP)

tolcapone (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

vanadyl sulfate (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoplasmic translation (ISO)

response to antineoplastic agent (IEP)

translation (IEA)

Cellular Component

cytoplasm (ISO)

cytosolic large ribosomal subunit (IBA,IDA,ISO)

cytosolic ribosome (ISO)

polysomal ribosome (ISO)

postsynaptic density (EXP,IDA,ISO)

ribonucleoprotein complex (IEA)

ribosome (IDA,IEA)

synapse (EXP,IDA)

Molecular Function

protein binding (IPI,ISO)

structural constituent of ribosome (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structures of the human and Drosophila 80S ribosome.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum.	Cheng D, etal., Mol Cell Proteomics. 2006 Jun;5(6):1158-70. doi: 10.1074/mcp.D500009-MCP200. Epub 2006 Feb 28.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Selective high-efficiency cross-linking of mammalian ribosomal proteins with cleavable thiol-directed heterobifunctional reagents: identification and binding directions of major protein complexes.	Hultin T Biochim Biophys Acta. 1986 Aug 15;872(3):226-35.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Isolation of cDNAs representing dithiolethione-responsive genes.	Primiano T, etal., Carcinogenesis 1996 Nov;17(11):2297-303.
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Differential expression of diacylglycerol kinase iota and L18A mRNAs in the brains of alcohol-preferring AA and alcohol-avoiding ANA rats.	Sommer W, etal., Mol Psychiatry. 2001 Jan;6(1):103-8; 5.
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.	Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.
13.	Isolation of eukaryotic ribosomal proteins. Purification and characterization of the 60 S ribosomal subunit proteins La, Lb, Lf, P1, P2, L13', L14, L18', L20, and L38.	Tsurugi K, etal., J Biol Chem. 1978 Feb 10;253(3):946-55.

Additional References at PubMed

PMID:2541017	PMID:7654221	PMID:12962325	PMID:15489334	PMID:19946888	PMID:22658674	PMID:22681889	PMID:24625528	PMID:25211037	PMID:25957688	PMID:30053369

Genomics

Comparative Map Data

Rpl18a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	16	18,542,555 - 18,544,578 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	18,542,566 - 18,545,546 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	18,584,772 - 18,586,795 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	19,717,450 - 19,719,473 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	18,637,713 - 18,639,736 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	20,293,277 - 20,295,283 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	20,293,229 - 20,295,294 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	20,150,821 - 20,152,827 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	19,042,063 - 19,044,069 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	19,042,060 - 19,044,067 (+)	NCBI
Celera	16	18,735,212 - 18,737,218 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

RPL18A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	17,859,910 - 17,863,319 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	17,859,910 - 17,864,153 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	17,970,719 - 17,974,128 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	17,831,727 - 17,835,124 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	17,831,730 - 17,835,124	NCBI
Celera	19	17,872,445 - 17,875,838 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	17,536,059 - 17,539,505 (+)	NCBI		HuRef
CHM1_1	19	17,970,422 - 17,973,868 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	17,993,996 - 17,997,405 (+)	NCBI		T2T-CHM13v2.0

Rpl18a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	71,347,366 - 71,350,087 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	71,347,366 - 71,350,056 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	70,894,722 - 70,897,443 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	70,894,722 - 70,897,412 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	73,418,621 - 73,421,342 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	73,824,368 - 73,826,387 (-)	NCBI		MGSCv36	mm8
Celera	8	73,456,025 - 73,458,747 (-)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.38	NCBI

Rpl18a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	3,384,209 - 3,387,743 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	3,385,056 - 3,387,743 (-)	NCBI	ChiLan1.0	ChiLan1.0

RPL18A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	19	21,731,503 - 21,734,993 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	17,341,788 - 17,345,278 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	18,315,535 - 18,318,978 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	18,315,535 - 18,318,978 (+)	Ensembl	panpan1.1		panPan2

RPL18A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	45,036,543 - 45,040,009 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	45,036,510 - 45,039,935 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	44,948,492 - 44,952,001 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	45,521,261 - 45,524,770 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	45,519,522 - 45,524,668 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	44,758,115 - 44,761,624 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	45,168,389 - 45,171,898 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	45,444,343 - 45,447,861 (-)	NCBI		UU_Cfam_GSD_1.0

Rpl18a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	203,643,098 - 203,648,946 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	3,194,254 - 3,198,155 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936596	3,194,952 - 3,198,020 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL18A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	59,890,796 - 59,897,024 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	59,892,788 - 59,906,242 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	59,462,228 - 59,465,636 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL18A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	16,335,899 - 16,339,446 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	16,335,857 - 16,339,620 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	3,047,961 - 3,051,518 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl18a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624908	1,395,810 - 1,400,043 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624908	1,395,752 - 1,398,595 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpl18a
2 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	106
Count of miRNA genes:	89
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000025421
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1600369	Hcas8	Hepatocarcinoma susceptibility QTL 8			liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	16	1	22477621	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26727669	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26727669	Rat
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	1	26727669	Rat
9590151	Scort8	Serum corticosterone level QTL 8	8.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	16	1	30836262	Rat
2302380	Slep6	Serum leptin concentration QTL 6	3.36		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	1	32139025	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33418960	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39533930	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39533930	Rat
631561	Hcuc2	Hepatic copper content QTL 2	2.8		liver copper amount (VT:0003065)	liver total copper weight (CMO:0001507)	16	1	39533949	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	1	43534949	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	1	44588133	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	44977551	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	16	380245	80345693	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	832236	46053497	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	832236	59492508	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	832236	59492508	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	832236	59492508	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	832236	59492508	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3380150	21361552	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3380150	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	43025077	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4227609	43025077	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4227609	46975965	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	4227609	48972724	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4227609	49227609	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4227609	60252231	Rat
631517	Scl9	Serum cholesterol level QTL 9	3.3		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	16	15726433	21034895	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor depth of invasion (CMO:0001888)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat
70205	Gcr3	Gastric cancer resistance QTL 3	2.3		stomach morphology trait (VT:0000470)	stomach tumor diameter (CMO:0001889)	16	17696791	82635055	Rat

Markers in Region

PMC83998P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,544,171 - 18,544,558 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,294,877 - 20,295,263	NCBI	Rnor6.0
Rnor_5.0	16	20,152,421 - 20,152,807	UniSTS	Rnor5.0
RGSC_v3.4	16	19,043,663 - 19,044,049	UniSTS	RGSC3.4
Celera	16	18,736,812 - 18,737,198	UniSTS
Cytogenetic Map	16	p14	UniSTS

MARC_4117-4118:991938388:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,543,748 - 18,543,950 (+)	MAPPER	mRatBN7.2
mRatBN7.2	6	48,544,181 - 48,544,292 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	51,246,027 - 51,246,137	NCBI	Rnor6.0
Rnor_6.0	16	20,294,454 - 20,294,655	NCBI	Rnor6.0
Rnor_5.0	16	20,151,998 - 20,152,199	UniSTS	Rnor5.0
Rnor_5.0	6	59,916,676 - 59,916,786	UniSTS	Rnor5.0
RGSC_v3.4	6	50,215,830 - 50,215,940	UniSTS	RGSC3.4
RGSC_v3.4	16	19,043,240 - 19,043,441	UniSTS	RGSC3.4
Celera	16	18,736,389 - 18,736,590	UniSTS
Celera	6	47,746,028 - 47,746,138	UniSTS
Cytogenetic Map	16	p14	UniSTS
Cytogenetic Map	6	q16	UniSTS

RH125499

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,543,705 - 18,544,026 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,294,411 - 20,294,731	NCBI	Rnor6.0
Rnor_5.0	16	20,151,955 - 20,152,275	UniSTS	Rnor5.0
RGSC_v3.4	16	19,043,197 - 19,043,517	UniSTS	RGSC3.4
Celera	16	18,736,346 - 18,736,666	UniSTS
Cytogenetic Map	16	p14	UniSTS

D14S105E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	18,544,292 - 18,544,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	20,294,998 - 20,295,173	NCBI	Rnor6.0
Rnor_5.0	16	20,152,542 - 20,152,717	UniSTS	Rnor5.0
RGSC_v3.4	16	19,043,784 - 19,043,959	UniSTS	RGSC3.4
Celera	16	18,736,933 - 18,737,108	UniSTS
Cytogenetic Map	16	p14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	3	22	24	18	16	18			41	18	32	2
Medium		21	33	23	3	23	8	11	33	17	9	9	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_212510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC058498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223818	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000025421 ⟹ ENSRNOP00000025421

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,542,566 - 18,544,578 (+)	Ensembl
Rnor_6.0 Ensembl	16	20,293,229 - 20,295,294 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109414 ⟹ ENSRNOP00000095031

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	16	18,542,566 - 18,545,546 (+)	Ensembl

RefSeq Acc Id:

NM_212510 ⟹ NP_997675

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	16	18,542,555 - 18,544,578 (+)	NCBI
Rnor_6.0	16	20,293,277 - 20,295,283 (+)	NCBI
Rnor_5.0	16	20,150,821 - 20,152,827 (+)	NCBI
RGSC_v3.4	16	19,042,063 - 19,044,069 (+)	RGD
Celera	16	18,735,212 - 18,737,218 (+)	RGD

Sequence:

show sequence

CCTTTTGTGAGTGGCAGTGAACGAGCACGCACTGCTATGAAGGCGTCGGGCACGCTTCGGGAGT
ACAAGGTGGTGGGGCGTTGCTTGCCAACCCCAAAATGCCACACACCGCCACTGTACCGAATGCG
AATCTTTGCACCCAACCATGTGGTGGCCAAGTCCCGCTTCTGGTACTTTGTGTCGCAGCTGAAG
AAGATGAAGAAGTCATCCGGGGAAATTGTGTACTGTGGGCAGGTGTTTGAGAAGTCACCCCTGC
GTGTGAAGAACTTCGGCATCTGGCTGCGCTATGATTCCCGAAGTGGCACTCACAACATGTACCG
AGAGTACCGGGACCTGACCACTGCCGGCGCGGTCACACAGTGCTACCGAGACATGGGTGCCCGA
CACCGTGCCCGTGCGCACTCCATCCAGATCATGAAGGTGGAAGAGATTGCAGCTGGCAAGTGCC
GCCGGCCAGCTGTCAAGCAGTTCCACGACTCCAAGATCAAGTTCCCATTGCCCCACCGTGTGTT
GCGGCGCCAGCACAAACCACGCTTCACCACCAAGAGGCCAAACACCTTCTTCTAGACACAGAGA
CCCACTGAATAAAAGCTTCAGACTGTCAAAAAAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_997675	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH58498	(Get FASTA)	NCBI Sequence Viewer
	EDL90752	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025421
	ENSRNOP00000059772.3
	ENSRNOP00000095031.1
GenBank Protein	P62718	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_997675 ⟸ NM_212510
- UniProtKB:	P62718 (UniProtKB/Swiss-Prot), A6K9Y4 (UniProtKB/TrEMBL), F1M0K6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYC GQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMK VEEIAAGKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF hide sequence

RefSeq Acc Id:

ENSRNOP00000025421 ⟸ ENSRNOT00000025421

RefSeq Acc Id:

ENSRNOP00000095031 ⟸ ENSRNOT00000109414

Protein Domains

Large ribosomal subunit protein eL20

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62718-F1-model_v2	AlphaFold	P62718	1-176	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700011

Promoter ID:

EPDNEW_R10534

Type:

multiple initiation site

Name:

Rpl18a_1

Description:

ribosomal protein L18A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	20,293,277 - 20,293,337	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1302976	AgrOrtholog
BioCyc Gene	G2FUF-11817	BioCyc
Ensembl Genes	ENSRNOG00000018795	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00000042547	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025421	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000068694.3	UniProtKB/TrEMBL
	ENSRNOT00000109414.1	UniProtKB/TrEMBL
Gene3D-CATH	3.10.20.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6919102	IMAGE-MGC_LOAD
InterPro	50S_L18Ae/Ribosomal_L18a/L20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L18a//L18Ae/LX	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ribosomal_L18a/L20_eukaryotes	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:290641	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72957	IMAGE-MGC_LOAD
NCBI Gene	290641	ENTREZGENE
PANTHER	60S RIBOSOMAL PROTEIN L18A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10052	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ribosomal_L18A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rpl18a	PhenoGen
PIRSF	Ribosomal_L18a	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018795	RatGTEx
	ENSRNOG00000042547	RatGTEx
Superfamily-SCOP	RplX-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AM85_RAT	UniProtKB/TrEMBL
	A6K9Y4	ENTREZGENE, UniProtKB/TrEMBL
	F1M0K6	ENTREZGENE, UniProtKB/TrEMBL
	P62718	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P11249	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Rpl18a	ribosomal protein L18A	MGC72957	similar to 60S ribosomal protein L18a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-02-14	MGC72957	similar to 60S ribosomal protein L18a			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations