Advanced Search (OLGA)

Gene: H1f0 (H1.0 linker histone) Mus musculus

Analyze

Symbol:

H1f0

Name:

H1.0 linker histone

RGD ID:

10703

MGI Page

MGI

Description:

Enables double-stranded DNA binding activity and minor groove of adenine-thymine-rich DNA binding activity. Predicted to be involved in chromosome condensation; heterochromatin formation; and negative regulation of DNA recombination. Located in nucleus. Is expressed in several structures, including brain; early conceptus; endocrine gland; female reproductive system; and gut. Orthologous to human H1-0 (H1.0 linker histone).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

D130017D06Rik; H1 histone family, member 0; H1(0); H1-0; H1-0 histone; H1f; H1fv; histone H1'; histone H1(0); histone H1.0; MGC117919; MGC19309; MGC98218; myD196

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	H1-0 (H1.0 linker histone)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	H1f0 (H1.0 linker histone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	LOC102010789 (histone H1.0)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100970460 (histone H1.0)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	H1-0 (H1.0 linker histone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101970440 (histone H1.0)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	H1-0 (H1.0 linker histone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	H1-0 (H1.0 linker histone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	LOC101717518 (histone H1.0)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	H1f0 (H1.0 linker histone)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	H1-0 (H1.0 linker histone)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	h1f0 (H1 histone family, member 0)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	HHO1	Alliance	DIOPT (Hieranoid\|InParanoid\|PANTHER)
Caenorhabditis elegans (roundworm):	hil-2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	hil-3	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	hil-6	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	his-24	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	h1-0	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	78,912,412 - 78,914,704 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	78,912,650 - 78,914,704 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	79,028,212 - 79,030,504 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	79,028,450 - 79,030,504 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	78,858,642 - 78,860,934 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	78,855,467 - 78,857,759 (+)	NCBI		MGSCv36	mm8
Celera	15	81,129,838 - 81,132,130 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.7	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	COVID-19		ISO	RGD:736127	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	adenylosuccinase lyase deficiency		ISO	RGD:736127	8554872	ClinVar Annotator: match by term: Adenylosuccinate lyase deficiency	ClinVar	PMID:28492532
H1f0	Mouse	Emery-Dreifuss muscular dystrophy		ISO	RGD:736127	8554872	ClinVar Annotator: match by term: Emery-Dreifuss muscular dystrophy	ClinVar	PMID:16783378\|PMID:18570303\|PMID:18799783\|PMID:22213678\|PMID:28492532
H1f0	Mouse	myoclonic dystonia 26		ISO	RGD:736127	8554872	ClinVar Annotator: match by term: Myoclonic dystonia 26	ClinVar	PMID:16783378\|PMID:18570303\|PMID:18799783\|PMID:22213678\|PMID:28492532
H1f0	Mouse	neurodegeneration with brain iron accumulation 2A		ISO	RGD:736127	8554872	ClinVar Annotator: match by term: Infantile neuroaxonal dystrophy	ClinVar	PMID:16783378\|PMID:18570303\|PMID:18799783\|PMID:22213678\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	acute myeloid leukemia		ISO	RGD:736127	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17330099

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	(-)-alpha-phellandrene	increases expression	ISO	RGD:736127	6480464	alpha phellandrene results in increased expression of H1F0 mRNA	CTD	PMID:25075043
H1f0	Mouse	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:736127	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of H1-0 mRNA	CTD	PMID:22079256
H1f0	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of H1F0 mRNA	CTD	PMID:36331819
H1f0	Mouse	1,2-dimethylhydrazine	increases expression	EXP		6480464	1,2-Dimethylhydrazine results in increased expression of H1F0 mRNA	CTD	PMID:22206623
H1f0	Mouse	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of H1F0 mRNA	CTD	PMID:17555576
H1f0	Mouse	17alpha-ethynylestradiol	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of H1F0 mRNA	CTD	PMID:17942748
H1f0	Mouse	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of H1F0 mRNA	CTD	PMID:39298647
H1f0	Mouse	2,3',4,4',5-Pentachlorobiphenyl	increases expression	EXP		6480464	2,3',4,4',5-pentachlorobiphenyl results in increased expression of H1F0 mRNA	CTD	PMID:31388691
H1f0	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of H1F0 mRNA	CTD	PMID:17942748
H1f0	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:2777	6480464	Tetrachlorodibenzodioxin results in decreased expression of H1F0 mRNA	CTD	PMID:20959002
H1f0	Mouse	2,4-diaminotoluene	decreases expression	EXP		6480464	2,4-diaminotoluene results in decreased expression of H1F0 mRNA	CTD	PMID:20713471
H1f0	Mouse	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:736127	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
H1f0	Mouse	2-methylcholine	affects expression	ISO	RGD:736127	6480464	beta-methylcholine affects the expression of H1-0 mRNA	CTD	PMID:21179406
H1f0	Mouse	3,4-methylenedioxymethamphetamine	increases expression	EXP		6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of H1F0 mRNA	CTD	PMID:20188158
H1f0	Mouse	3-chloropropane-1,2-diol	decreases expression	ISO	RGD:2777	6480464	alpha-Chlorohydrin results in decreased expression of H1F0 mRNA	CTD	PMID:28522335
H1f0	Mouse	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:736127	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
H1f0	Mouse	3H-1,2-dithiole-3-thione	decreases expression	ISO	RGD:2777	6480464	1,2-dithiol-3-thione results in decreased expression of H1F0 mRNA	CTD	PMID:19162173
H1f0	Mouse	4,4'-sulfonyldiphenol	affects expression	EXP		6480464	bisphenol S affects the expression of H1F0 mRNA	CTD	PMID:39298647
H1f0	Mouse	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:736127	6480464	bisphenol S results in increased expression of H1-0 protein	CTD	PMID:34186270
H1f0	Mouse	4-amino-2,6-dinitrotoluene	affects expression	ISO	RGD:2777	6480464	4-amino-2,6-dinitrotoluene affects the expression of H1F0 mRNA	CTD	PMID:21346803
H1f0	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of H1F0 mRNA	CTD	PMID:28973697
H1f0	Mouse	5-aza-2'-deoxycytidine	multiple interactions	ISO	RGD:736127	6480464	[Decitabine co-treated with Vorinostat] affects the expression of H1-0 mRNA	CTD	PMID:17330099
H1f0	Mouse	5-azacytidine	increases expression	ISO	RGD:736127	6480464	Azacitidine results in increased expression of H1-0 protein	CTD	PMID:16006241
H1f0	Mouse	5-fluorouracil	affects expression	EXP		6480464	Fluorouracil affects the expression of H1F0 mRNA	CTD	PMID:20421339
H1f0	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	RGD:2777	6480464	Propylthiouracil results in decreased expression of H1F0 mRNA	CTD	PMID:30047161
H1f0	Mouse	acrylamide	decreases expression	ISO	RGD:2777	6480464	Acrylamide results in decreased expression of H1F0 mRNA	CTD	PMID:28959563
H1f0	Mouse	acrylamide	decreases expression	ISO	RGD:736127	6480464	Acrylamide results in decreased expression of H1-0 mRNA	CTD	PMID:32763439
H1f0	Mouse	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of H1F0 mRNA	CTD	PMID:30807115
H1f0	Mouse	actinomycin D	multiple interactions	ISO	RGD:736127	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of H1-0 protein	CTD	PMID:38460933
H1f0	Mouse	aflatoxin B1	increases expression	ISO	RGD:2777	6480464	Aflatoxin B1 results in increased expression of H1F0 mRNA	CTD	PMID:33354967
H1f0	Mouse	all-trans-retinoic acid	increases expression	ISO	RGD:736127	6480464	Tretinoin results in increased expression of H1-0 mRNA; Tretinoin results in increased expression of H1-0 more ...	CTD	PMID:16006241\|PMID:21934132\|PMID:33167477
H1f0	Mouse	all-trans-retinoic acid	affects expression	EXP		6480464	Tretinoin affects the expression of H1F0 mRNA	CTD	PMID:20421339
H1f0	Mouse	alpha-phellandrene	increases expression	ISO	RGD:736127	6480464	alpha phellandrene results in increased expression of H1F0 mRNA	CTD	PMID:25075043
H1f0	Mouse	amitrole	decreases expression	ISO	RGD:2777	6480464	Amitrole results in decreased expression of H1F0 mRNA	CTD	PMID:30047161
H1f0	Mouse	ammonium chloride	affects expression	ISO	RGD:2777	6480464	Ammonium Chloride affects the expression of H1F0 mRNA	CTD	PMID:16483693
H1f0	Mouse	Ampullosporin	multiple interactions	ISO	RGD:2777	6480464	[ampullosporin co-treated with Ketamine] results in increased expression of H1F0 mRNA	CTD	PMID:16635253
H1f0	Mouse	aristolochic acid A	decreases expression	ISO	RGD:736127	6480464	aristolochic acid I results in decreased expression of H1F0 mRNA	CTD	PMID:33212167
H1f0	Mouse	arsane	multiple interactions	ISO	RGD:736127	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
H1f0	Mouse	arsenic atom	multiple interactions	ISO	RGD:736127	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
H1f0	Mouse	arsenite(3-)	decreases expression	EXP		6480464	arsenite results in decreased expression of H1F0 mRNA	CTD	PMID:18929588
H1f0	Mouse	arsenous acid	decreases expression	ISO	RGD:736127	6480464	Arsenic Trioxide results in decreased expression of H1-0 mRNA	CTD	PMID:22521957
H1f0	Mouse	belinostat	increases expression	ISO	RGD:736127	6480464	belinostat results in increased expression of H1-0 mRNA	CTD	PMID:19606018\|PMID:27188386
H1f0	Mouse	benzo[a]pyrene	decreases expression	ISO	RGD:736127	6480464	Benzo(a)pyrene results in decreased expression of H1-0 mRNA	CTD	PMID:22316170
H1f0	Mouse	benzo[a]pyrene	decreases methylation	ISO	RGD:736127	6480464	Benzo(a)pyrene results in decreased methylation of H1F0 promoter	CTD	PMID:27901495
H1f0	Mouse	benzo[a]pyrene	affects methylation	ISO	RGD:736127	6480464	Benzo(a)pyrene affects the methylation of H1F0 exon	CTD	PMID:27901495
H1f0	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of H1F0 mRNA	CTD	PMID:22228805
H1f0	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:736127	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of H1-0 mRNA	CTD	PMID:19150397\|PMID:20018196\|PMID:20382639
H1f0	Mouse	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:2777	6480464	[bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of H1F0 more ...	CTD	PMID:23359474
H1f0	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of H1F0 mRNA	CTD	PMID:33754040
H1f0	Mouse	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:736127	6480464	Diethylhexyl Phthalate results in decreased expression of H1F0 mRNA	CTD	PMID:31163220
H1f0	Mouse	bisphenol A	multiple interactions	ISO	RGD:2777	6480464	[bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of H1F0 more ...	CTD	PMID:23359474
H1f0	Mouse	bisphenol A	increases expression	ISO	RGD:736127	6480464	bisphenol A results in increased expression of H1-0 protein	CTD	PMID:34186270\|PMID:37567409
H1f0	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of H1F0 mRNA	CTD	PMID:34585602
H1f0	Mouse	bisphenol A	affects expression	ISO	RGD:2777	6480464	bisphenol A affects the expression of H1F0 mRNA	CTD	PMID:30903817
H1f0	Mouse	bisphenol A	affects expression	ISO	RGD:736127	6480464	bisphenol A affects the expression of H1F0 mRNA	CTD	PMID:30903817
H1f0	Mouse	bisphenol A	multiple interactions	ISO	RGD:736127	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
H1f0	Mouse	bisphenol A	increases expression	ISO	RGD:2777	6480464	bisphenol A results in increased expression of H1F0 mRNA	CTD	PMID:25181051
H1f0	Mouse	bisphenol AF	increases expression	ISO	RGD:736127	6480464	bisphenol AF results in increased expression of H1-0 protein	CTD	PMID:34186270
H1f0	Mouse	Bisphenol B	increases expression	ISO	RGD:736127	6480464	bisphenol B results in increased expression of H1-0 protein	CTD	PMID:34186270
H1f0	Mouse	bisphenol F	increases expression	ISO	RGD:736127	6480464	bisphenol F results in increased expression of H1-0 protein	CTD	PMID:34186270
H1f0	Mouse	bleomycin A2	affects expression	ISO	RGD:2777	6480464	Bleomycin affects the expression of H1F0 protein	CTD	PMID:25933445
H1f0	Mouse	Brodifacoum	decreases expression	ISO	RGD:2777	6480464	bromfenacoum results in decreased expression of H1F0 protein	CTD	PMID:28903499
H1f0	Mouse	buspirone	decreases expression	ISO	RGD:2777	6480464	Buspirone results in decreased expression of H1F0 mRNA	CTD	PMID:24136188
H1f0	Mouse	cadmium atom	multiple interactions	ISO	RGD:736127	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of H1-0 more ...	CTD	PMID:35301059
H1f0	Mouse	cadmium dichloride	decreases expression	ISO	RGD:736127	6480464	Cadmium Chloride results in decreased expression of H1-0 mRNA	CTD	PMID:38568856
H1f0	Mouse	cadmium dichloride	multiple interactions	ISO	RGD:736127	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of H1-0 more ...	CTD	PMID:35301059
H1f0	Mouse	caffeine	decreases expression	ISO	RGD:736127	6480464	Caffeine results in decreased expression of H1F0 protein	CTD	PMID:31195006
H1f0	Mouse	carbamazepine	affects expression	ISO	RGD:736127	6480464	Carbamazepine affects the expression of H1-0 mRNA	CTD	PMID:25979313
H1f0	Mouse	chlordecone	increases expression	EXP		6480464	Chlordecone results in increased expression of H1F0 mRNA	CTD	PMID:33711761
H1f0	Mouse	chlormequat chloride	increases expression	ISO	RGD:2777	6480464	Chlormequat results in increased expression of H1-0 protein	CTD	PMID:34958886
H1f0	Mouse	chlorpyrifos	decreases expression	EXP		6480464	Chlorpyrifos results in decreased expression of H1F0 mRNA	CTD	PMID:37019170
H1f0	Mouse	chromium(6+)	decreases expression	ISO	RGD:736127	6480464	chromium hexavalent ion results in decreased expression of H1-0 mRNA	CTD	PMID:30690063
H1f0	Mouse	cisplatin	increases expression	ISO	RGD:2777	6480464	Cisplatin results in increased expression of H1F0 mRNA	CTD	PMID:22023808
H1f0	Mouse	cisplatin	multiple interactions	ISO	RGD:736127	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of H1-0 mRNA	CTD	PMID:27392435
H1f0	Mouse	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of H1F0 mRNA	CTD	PMID:25270620
H1f0	Mouse	clobetasol	increases expression	EXP		6480464	Clobetasol results in increased expression of H1F0 mRNA	CTD	PMID:27462272
H1f0	Mouse	clofibrate	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of H1F0 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
H1f0	Mouse	clofibrate	decreases expression	EXP		6480464	Clofibrate results in decreased expression of H1F0 mRNA	CTD	PMID:17585979
H1f0	Mouse	cobalt dichloride	decreases expression	ISO	RGD:736127	6480464	cobaltous chloride results in decreased expression of H1-0 mRNA	CTD	PMID:19320972\|PMID:19376846
H1f0	Mouse	cobalt dichloride	decreases expression	ISO	RGD:2777	6480464	cobaltous chloride results in decreased expression of H1F0 mRNA	CTD	PMID:24386269
H1f0	Mouse	copper(II) chloride	decreases expression	ISO	RGD:736127	6480464	cupric chloride results in decreased expression of H1-0 mRNA	CTD	PMID:38568856
H1f0	Mouse	copper(II) sulfate	affects expression	ISO	RGD:736127	6480464	Copper Sulfate affects the expression of H1-0 mRNA	CTD	PMID:19549813
H1f0	Mouse	crocidolite asbestos	increases expression	ISO	RGD:736127	6480464	Asbestos, Crocidolite results in increased expression of H1-0 mRNA	CTD	PMID:18687144
H1f0	Mouse	cyclosporin A	increases expression	ISO	RGD:736127	6480464	Cyclosporine results in increased expression of H1-0 mRNA	CTD	PMID:20106945\|PMID:25562108
H1f0	Mouse	deguelin	increases expression	ISO	RGD:736127	6480464	deguelin results in increased expression of H1-0 mRNA	CTD	PMID:33512557
H1f0	Mouse	deoxynivalenol	increases expression	ISO	RGD:736127	6480464	deoxynivalenol results in increased expression of H1-0 mRNA	CTD	PMID:31863870
H1f0	Mouse	dexamethasone	multiple interactions	ISO	RGD:736127	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
H1f0	Mouse	diarsenic trioxide	decreases expression	ISO	RGD:736127	6480464	Arsenic Trioxide results in decreased expression of H1-0 mRNA	CTD	PMID:22521957
H1f0	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of H1F0 mRNA	CTD	PMID:21266533
H1f0	Mouse	dibutyl phthalate	multiple interactions	ISO	RGD:2777	6480464	[bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of H1F0 more ...	CTD	PMID:23359474
H1f0	Mouse	dibutyl phthalate	decreases expression	ISO	RGD:2777	6480464	Dibutyl Phthalate results in decreased expression of H1F0 mRNA	CTD	PMID:17379624\|PMID:21266533
H1f0	Mouse	dimethylarsinic acid	increases expression	ISO	RGD:2777	6480464	Cacodylic Acid results in increased expression of H1F0 mRNA	CTD	PMID:16122865
H1f0	Mouse	disodium selenite	decreases expression	ISO	RGD:736127	6480464	Sodium Selenite results in decreased expression of H1-0 mRNA	CTD	PMID:18175754
H1f0	Mouse	diuron	increases expression	ISO	RGD:2777	6480464	Diuron results in increased expression of H1F0 mRNA	CTD	PMID:21551480
H1f0	Mouse	dorsomorphin	multiple interactions	ISO	RGD:736127	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
H1f0	Mouse	doxorubicin	increases expression	ISO	RGD:736127	6480464	Doxorubicin results in increased expression of H1-0 mRNA	CTD	PMID:29803840
H1f0	Mouse	ethanol	decreases expression	ISO	RGD:736127	6480464	Ethanol results in decreased expression of H1-0 mRNA	CTD	PMID:28986285
H1f0	Mouse	fipronil	increases expression	ISO	RGD:2777	6480464	fipronil results in increased expression of H1F0 mRNA	CTD	PMID:34044035
H1f0	Mouse	flutamide	decreases expression	ISO	RGD:2777	6480464	Flutamide results in decreased expression of H1F0 mRNA	CTD	PMID:24136188
H1f0	Mouse	FR900359	decreases phosphorylation	ISO	RGD:736127	6480464	FR900359 results in decreased phosphorylation of H1-0 protein	CTD	PMID:37730182
H1f0	Mouse	furan	decreases expression	ISO	RGD:2777	6480464	furan results in decreased expression of H1F0 mRNA	CTD	PMID:25539665\|PMID:26194646
H1f0	Mouse	furfural	multiple interactions	ISO	RGD:736127	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
H1f0	Mouse	genistein	multiple interactions	ISO	RGD:736127	6480464	ESR2 promotes the reaction [Genistein results in increased expression of H1-0 protein]	CTD	PMID:20884965
H1f0	Mouse	genistein	increases expression	ISO	RGD:736127	6480464	Genistein results in increased expression of H1-0 protein	CTD	PMID:20884965
H1f0	Mouse	glyphosate	decreases expression	EXP		6480464	Glyphosate results in decreased expression of H1F0 protein	CTD	PMID:37208198
H1f0	Mouse	hydrogen peroxide	affects expression	ISO	RGD:736127	6480464	Hydrogen Peroxide affects the expression of H1-0 mRNA	CTD	PMID:20044591
H1f0	Mouse	indometacin	multiple interactions	ISO	RGD:736127	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
H1f0	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of H1F0 mRNA	CTD	PMID:36331819
H1f0	Mouse	ketamine	multiple interactions	ISO	RGD:2777	6480464	[ampullosporin co-treated with Ketamine] results in increased expression of H1F0 mRNA	CTD	PMID:16635253
H1f0	Mouse	manganese atom	multiple interactions	ISO	RGD:736127	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
H1f0	Mouse	manganese(0)	multiple interactions	ISO	RGD:736127	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
H1f0	Mouse	manganese(II) chloride	multiple interactions	ISO	RGD:736127	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
H1f0	Mouse	methapyrilene	decreases expression	ISO	RGD:2777	6480464	Methapyrilene results in decreased expression of H1F0 mRNA	CTD	PMID:30467583
H1f0	Mouse	methimazole	decreases expression	ISO	RGD:2777	6480464	Methimazole results in decreased expression of H1F0 mRNA	CTD	PMID:30047161
H1f0	Mouse	methoxyacetic acid	increases expression	ISO	RGD:2777	6480464	methoxyacetic acid results in increased expression of H1F0 mRNA	CTD	PMID:18199887
H1f0	Mouse	methoxyacetic acid	affects expression	EXP		6480464	methoxyacetic acid affects the expression of H1F0 mRNA	CTD	PMID:20421339
H1f0	Mouse	methylmercury chloride	decreases expression	ISO	RGD:736127	6480464	methylmercuric chloride results in decreased expression of H1-0 mRNA	CTD	PMID:28001369
H1f0	Mouse	methylseleninic acid	affects expression	ISO	RGD:736127	6480464	methylselenic acid affects the expression of H1-0 mRNA	CTD	PMID:14617803
H1f0	Mouse	mitomycin C	decreases expression	EXP		6480464	Mitomycin results in decreased expression of H1F0 mRNA	CTD	PMID:25270620
H1f0	Mouse	Monobutylphthalate	affects expression	EXP		6480464	monobutyl phthalate affects the expression of H1F0 mRNA	CTD	PMID:20421339
H1f0	Mouse	Muraglitazar	increases expression	ISO	RGD:2777	6480464	muraglitazar results in increased expression of H1F0 mRNA	CTD	PMID:21515302
H1f0	Mouse	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:736127	6480464	1-Methyl-4-phenylpyridinium results in increased expression of H1-0 mRNA	CTD	PMID:24810058
H1f0	Mouse	nefazodone	decreases expression	ISO	RGD:2777	6480464	nefazodone results in decreased expression of H1F0 mRNA	CTD	PMID:24136188
H1f0	Mouse	nickel sulfate	decreases expression	ISO	RGD:736127	6480464	nickel sulfate results in decreased expression of H1-0 mRNA	CTD	PMID:22714537
H1f0	Mouse	nimesulide	decreases expression	ISO	RGD:2777	6480464	nimesulide results in decreased expression of H1F0 mRNA	CTD	PMID:24136188
H1f0	Mouse	Nutlin-3	multiple interactions	ISO	RGD:736127	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of H1-0 protein	CTD	PMID:38460933
H1f0	Mouse	oxaliplatin	multiple interactions	ISO	RGD:2777	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of H1F0 mRNA	CTD	PMID:25729387
H1f0	Mouse	oxaliplatin	decreases expression	ISO	RGD:2777	6480464	oxaliplatin results in decreased expression of H1F0 mRNA	CTD	PMID:25729387
H1f0	Mouse	paracetamol	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of H1F0 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
H1f0	Mouse	paracetamol	increases expression	ISO	RGD:736127	6480464	Acetaminophen results in increased expression of H1-0 mRNA	CTD	PMID:29067470
H1f0	Mouse	perfluorononanoic acid	increases expression	ISO	RGD:736127	6480464	perfluoro-n-nonanoic acid results in increased expression of H1-0 mRNA	CTD	PMID:32588087
H1f0	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of H1F0 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
H1f0	Mouse	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of H1F0 protein	CTD	PMID:28126411
H1f0	Mouse	perfluorooctanoic acid	increases expression	ISO	RGD:736127	6480464	perfluorooctanoic acid results in increased expression of H1-0 protein	CTD	PMID:26879310
H1f0	Mouse	phenobarbital	affects expression	ISO	RGD:2777	6480464	Phenobarbital affects the expression of H1F0 mRNA	CTD	PMID:19162173
H1f0	Mouse	phenylmercury acetate	decreases expression	ISO	RGD:736127	6480464	Phenylmercuric Acetate results in decreased expression of H1-0 mRNA	CTD	PMID:26272509
H1f0	Mouse	phenylmercury acetate	multiple interactions	ISO	RGD:736127	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
H1f0	Mouse	piperonyl butoxide	decreases expression	ISO	RGD:2777	6480464	Piperonyl Butoxide results in decreased expression of H1F0 mRNA	CTD	PMID:22484513
H1f0	Mouse	pirinixic acid	multiple interactions	ISO	RGD:736127	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
H1f0	Mouse	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of H1F0 mRNA	CTD	PMID:18445702
H1f0	Mouse	potassium chromate	multiple interactions	ISO	RGD:736127	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of H1-0 mRNA	CTD	PMID:22079256
H1f0	Mouse	potassium chromate	decreases expression	ISO	RGD:736127	6480464	potassium chromate(VI) results in decreased expression of H1-0 mRNA	CTD	PMID:22079256\|PMID:22714537
H1f0	Mouse	potassium dichromate	decreases expression	EXP		6480464	Potassium Dichromate results in decreased expression of H1F0 mRNA	CTD	PMID:23608068
H1f0	Mouse	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	RGD:2777	6480464	Pregnenolone Carbonitrile results in decreased expression of H1F0 mRNA	CTD	PMID:19162173
H1f0	Mouse	propiconazole	decreases expression	EXP		6480464	propiconazole results in decreased expression of H1F0 mRNA	CTD	PMID:19363144
H1f0	Mouse	quercetin	affects expression	ISO	RGD:2777	6480464	Quercetin affects the expression of H1F0 mRNA	CTD	PMID:18178720
H1f0	Mouse	SB 431542	multiple interactions	ISO	RGD:736127	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
H1f0	Mouse	silver atom	decreases expression	ISO	RGD:736127	6480464	Silver results in decreased expression of H1-0 mRNA	CTD	PMID:26014281
H1f0	Mouse	silver(0)	decreases expression	ISO	RGD:736127	6480464	Silver results in decreased expression of H1-0 mRNA	CTD	PMID:26014281
H1f0	Mouse	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of H1F0 mRNA	CTD	PMID:16014739
H1f0	Mouse	sodium arsenite	multiple interactions	ISO	RGD:736127	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ...	CTD	PMID:39836092
H1f0	Mouse	sodium chloride	multiple interactions	ISO	RGD:736127	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of H1-0 protein; [Sodium Chloride co-treated more ...	CTD	PMID:38598786
H1f0	Mouse	sodium fluoride	increases expression	EXP		6480464	Sodium Fluoride results in increased expression of H1F0 protein	CTD	PMID:28918527
H1f0	Mouse	Soman	increases expression	ISO	RGD:2777	6480464	Soman results in increased expression of H1F0 mRNA	CTD	PMID:19281266
H1f0	Mouse	sulfadimethoxine	decreases expression	ISO	RGD:2777	6480464	Sulfadimethoxine results in decreased expression of H1F0 mRNA	CTD	PMID:30047161
H1f0	Mouse	sulforaphane	decreases expression	ISO	RGD:736127	6480464	sulforaphane results in decreased expression of H1-0 mRNA	CTD	PMID:31838189
H1f0	Mouse	sunitinib	increases expression	ISO	RGD:736127	6480464	Sunitinib results in increased expression of H1-0 mRNA	CTD	PMID:31533062
H1f0	Mouse	tamoxifen	affects expression	ISO	RGD:736127	6480464	Tamoxifen affects the expression of H1-0 mRNA	CTD	PMID:14699072
H1f0	Mouse	tamoxifen	affects expression	EXP		6480464	Tamoxifen affects the expression of H1F0 mRNA	CTD	PMID:17555576
H1f0	Mouse	tebufenpyrad	increases expression	ISO	RGD:736127	6480464	4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of H1-0 mRNA	CTD	PMID:33512557
H1f0	Mouse	thapsigargin	decreases expression	ISO	RGD:2777	6480464	Thapsigargin results in decreased expression of H1F0 protein	CTD	PMID:35544339
H1f0	Mouse	thifluzamide	increases expression	ISO	RGD:736127	6480464	thifluzamide results in increased expression of H1-0 mRNA	CTD	PMID:33512557
H1f0	Mouse	thimerosal	decreases expression	ISO	RGD:736127	6480464	Thimerosal results in decreased expression of H1-0 mRNA	CTD	PMID:27188386
H1f0	Mouse	thiram	decreases expression	ISO	RGD:736127	6480464	Thiram results in decreased expression of H1-0 mRNA	CTD	PMID:38568856
H1f0	Mouse	titanium dioxide	increases methylation	EXP		6480464	titanium dioxide results in increased methylation of H1F0 gene; titanium dioxide results in increased methylation more ...	CTD	PMID:35295148
H1f0	Mouse	topotecan	multiple interactions	ISO	RGD:2777	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of H1F0 mRNA	CTD	PMID:25729387
H1f0	Mouse	topotecan	decreases expression	ISO	RGD:2777	6480464	Topotecan results in decreased expression of H1F0 mRNA	CTD	PMID:25729387
H1f0	Mouse	triadimefon	decreases expression	EXP		6480464	triadimefon results in decreased expression of H1F0 mRNA	CTD	PMID:19363144
H1f0	Mouse	trichostatin A	increases expression	ISO	RGD:736127	6480464	trichostatin A results in increased expression of H1-0 mRNA	CTD	PMID:19606018\|PMID:24935251
H1f0	Mouse	triphenyl phosphate	affects expression	ISO	RGD:736127	6480464	triphenyl phosphate affects the expression of H1F0 mRNA	CTD	PMID:37042841
H1f0	Mouse	triphenyl phosphate	affects expression	ISO	RGD:2777	6480464	triphenyl phosphate affects the expression of H1F0 mRNA	CTD	PMID:30589522
H1f0	Mouse	trovafloxacin	decreases expression	EXP		6480464	trovafloxacin results in decreased expression of H1F0 mRNA	CTD	PMID:35537566
H1f0	Mouse	tunicamycin	increases expression	ISO	RGD:736127	6480464	Tunicamycin results in increased expression of H1-0 mRNA	CTD	PMID:29453283
H1f0	Mouse	urethane	decreases expression	ISO	RGD:736127	6480464	Urethane results in decreased expression of H1-0 mRNA	CTD	PMID:28818685
H1f0	Mouse	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of H1F0 mRNA	CTD	PMID:17292431\|PMID:20421339
H1f0	Mouse	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of H1F0 mRNA	CTD	PMID:15799026\|PMID:19136453\|PMID:20546886\|PMID:21427059\|PMID:31445079
H1f0	Mouse	valproic acid	increases expression	ISO	RGD:736127	6480464	Valproic Acid results in increased expression of H1-0 mRNA	CTD	PMID:23179753\|PMID:24935251\|PMID:29154799
H1f0	Mouse	valproic acid	affects expression	ISO	RGD:736127	6480464	Valproic Acid affects the expression of H1-0 mRNA	CTD	PMID:25979313
H1f0	Mouse	vinclozolin	decreases expression	ISO	RGD:2777	6480464	vinclozolin results in decreased expression of H1F0 mRNA	CTD	PMID:23034163
H1f0	Mouse	vorinostat	multiple interactions	ISO	RGD:736127	6480464	[Decitabine co-treated with Vorinostat] affects the expression of H1-0 mRNA	CTD	PMID:17330099

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	chromosome condensation	involved_in	IBA	PANTHER:PTN000157378\|SGD:S000006048\|UniProtKB:P60008	2290270		GO_Central	GO_REF:0000033
H1f0	Mouse	heterochromatin formation	involved_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	heterochromatin formation	involved_in	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	negative regulation of DNA recombination	involved_in	IBA	PANTHER:PTN000157378\|SGD:S000006048	2290270		GO_Central	GO_REF:0000033
H1f0	Mouse	nucleosome assembly	involved_in	IEA	InterPro:IPR005818\|InterPro:IPR005819	2290270		InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	actin cytoskeleton	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	actin cytoskeleton	located_in	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	chromatin	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	euchromatin	located_in	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	euchromatin	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	Golgi apparatus	located_in	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	Golgi apparatus	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	nuclear body	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	nuclear body	located_in	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	nucleolus	NOT\|located_in	IDA		2290270	PMID:22868987	UniProt	PMID:22868987
H1f0	Mouse	nucleoplasm	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	nucleosome	part_of	IEA	InterPro:IPR005818\|InterPro:IPR005819	2290270		InterPro	GO_REF:0000002
H1f0	Mouse	nucleus	located_in	IDA		2290270	PMID:12606334, PMID:22868987, PMID:9067599	UniProt	PMID:12606334\|PMID:22868987\|PMID:9067599
H1f0	Mouse	nucleus	is_active_in	IBA	PANTHER:PTN000157378\|UniProtKB:P07305\|SGD:S000006048\|UniProtKB:P16403\|UniProtKB:Q9P8F8\|TAIR:locus:2006862\|UniProtKB:Q92522\|UniProtKB:P02259\|MGI:2176207\|MGI:1888530\|UniProtKB:Q3HNG7\|UniProtKB:Q02539\|UniProtKB:P16401\|UniProtKB:Q9FYS5\|MGI:95893\|WB:WBGene00001852\|dictyBase:DDB_G0285319\|MGI:1931527\|UniProtKB:P60008\|MGI:1931523\|WB:WBGene00001898\|UniProtKB:P10412	2290270		GO_Central	GO_REF:0000033
H1f0	Mouse	nucleus	located_in	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	transcription repressor complex	part_of	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	transcription repressor complex	part_of	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f0	Mouse	chromatin DNA binding	enables	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	chromatin DNA binding	enables	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	DNA binding	enables	EXP		2290270	PMID:11584004	DisProt	PMID:11584004
H1f0	Mouse	double-stranded DNA binding	enables	IBA	PANTHER:PTN000157378\|MGI:95893\|MGI:1888530\|RGD:2776	2290270		GO_Central	GO_REF:0000033
H1f0	Mouse	double-stranded DNA binding	enables	IMP		2290270	PMID:16006555	CAFA	PMID:16006555
H1f0	Mouse	minor groove of adenine-thymine-rich DNA binding	enables	IMP		2290270	PMID:11413144	CAFA	PMID:11413144
H1f0	Mouse	nucleosomal DNA binding	enables	IBA	PANTHER:PTN000157378\|UniProtKB:P02259\|MGI:2176207	2290270		GO_Central	GO_REF:0000033
H1f0	Mouse	nucleosome binding	enables	ISO	UniProtKB:P07305	2290270		GO_Central	GO_REF:0000119
H1f0	Mouse	nucleosome binding	enables	IEA	UniProtKB:P07305\|ensembl:ENSP00000344504	2290270		Ensembl	GO_REF:0000107
H1f0	Mouse	protein binding	enables	ISO	UniProtKB:P04014	9068941	PMID:9499053	IntAct	PMID:9499053
H1f0	Mouse	protein binding	enables	ISO	UniProtKB:P06454	9068941	PMID:29466338	DisProt	PMID:29466338
H1f0	Mouse	protein binding	enables	ISO	UniProtKB:Q8IYW5	9068941	PMID:26503038	IntAct	PMID:26503038
H1f0	Mouse	protein binding	enables	ISO	UniProtKB:Q16778\|UniProtKB:Q8IUE6\|UniProtKB:Q99878	9068941	PMID:30021884, PMID:35271311	IntAct	PMID:30021884\|PMID:35271311
H1f0	Mouse	structural constituent of chromatin	enables	IEA	InterPro:IPR005819	2290270		InterPro	GO_REF:0000002

Disease Annotations Click to see Annotation Detail View

acute myeloid leukemia (ISO)

adenylosuccinase lyase deficiency (ISO)

COVID-19 (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

myoclonic dystonia 26 (ISO)

neurodegeneration with brain iron accumulation 2A (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (EXP)

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,3',4,4',5-Pentachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-amino-2,6-dinitrotoluene (ISO)

4-hydroxyphenyl retinamide (EXP)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

5-fluorouracil (EXP)

6-propyl-2-thiouracil (ISO)

acrylamide (EXP,ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-phellandrene (ISO)

amitrole (ISO)

ammonium chloride (ISO)

Ampullosporin (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (EXP)

arsenous acid (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

Brodifacoum (ISO)

buspirone (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbamazepine (ISO)

chlordecone (EXP)

chlormequat chloride (ISO)

chlorpyrifos (EXP)

chromium(6+) (ISO)

cisplatin (EXP,ISO)

clobetasol (EXP)

clofibrate (EXP)

cobalt dichloride (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

deguelin (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

dimethylarsinic acid (ISO)

disodium selenite (ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

fipronil (ISO)

flutamide (ISO)

FR900359 (ISO)

furan (ISO)

furfural (ISO)

genistein (ISO)

glyphosate (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

inulin (EXP)

ketamine (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methimazole (ISO)

methoxyacetic acid (EXP,ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

mitomycin C (EXP)

Monobutylphthalate (EXP)

Muraglitazar (ISO)

N-methyl-4-phenylpyridinium (ISO)

nefazodone (ISO)

nickel sulfate (ISO)

nimesulide (ISO)

Nutlin-3 (ISO)

oxaliplatin (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

piperonyl butoxide (ISO)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

potassium dichromate (EXP)

pregnenolone 16alpha-carbonitrile (ISO)

propiconazole (EXP)

quercetin (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium fluoride (EXP)

Soman (ISO)

sulfadimethoxine (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (EXP,ISO)

tebufenpyrad (ISO)

thapsigargin (ISO)

thifluzamide (ISO)

thimerosal (ISO)

thiram (ISO)

titanium dioxide (EXP)

topotecan (ISO)

triadimefon (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

trovafloxacin (EXP)

tunicamycin (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

vinclozolin (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromosome condensation (IBA)

heterochromatin formation (IEA,ISO)

negative regulation of DNA recombination (IBA)

nucleosome assembly (IEA)

Cellular Component

actin cytoskeleton (IEA,ISO)

chromatin (ISO)

euchromatin (IEA,ISO)

Golgi apparatus (IEA,ISO)

nuclear body (IEA,ISO)

nucleolus (IDA)

nucleoplasm (ISO)

nucleosome (IEA)

nucleus (IBA,IDA,ISO)

transcription repressor complex (IEA,ISO)

Molecular Function

chromatin DNA binding (IEA,ISO)

DNA binding (EXP)

double-stranded DNA binding (IBA,IMP)

minor groove of adenine-thymine-rich DNA binding (IMP)

nucleosomal DNA binding (IBA)

nucleosome binding (IEA,ISO)

protein binding (ISO)

structural constituent of chromatin (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	MGD IEA	MGD IEA
4.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comparative analyses of the Dominant megacolon-SOX10 genomic interval in mouse and human.	Southard-Smith EM, etal., Mamm Genome 1999 Jul;10(7):744-9.

Additional References at PubMed

PMID:1354638	PMID:1690380	PMID:2806918	PMID:2846273	PMID:7547992	PMID:7604008	PMID:7612613	PMID:7626218	PMID:7891682	PMID:7925412	PMID:8168529	PMID:8299878
PMID:8559662	PMID:8589518	PMID:8660437	PMID:8735954	PMID:8889548	PMID:9067599	PMID:9069173	PMID:9079620	PMID:9425902	PMID:9499577	PMID:9560246	PMID:9562388
PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11343650	PMID:11413144	PMID:11479299	PMID:11584004	PMID:11689686	PMID:11803372	PMID:12149419
PMID:12477932	PMID:12606334	PMID:12808097	PMID:14561402	PMID:14668337	PMID:15306695	PMID:15489334	PMID:15782199	PMID:16006555	PMID:16141072	PMID:16141073	PMID:20926656
PMID:21267068	PMID:21503884	PMID:21873635	PMID:22650316	PMID:22701719	PMID:22868987	PMID:22922362	PMID:23645681	PMID:25645921	PMID:25680957	PMID:26336360	PMID:26381412
PMID:26689747	PMID:27113764	PMID:28378742	PMID:28766996	PMID:28794128	PMID:29802390	PMID:30457570	PMID:30562941	PMID:32512172	PMID:32554809	PMID:33299181	PMID:34321999
PMID:36417873	PMID:36928068	PMID:37142655	PMID:38355793

Genomics

Comparative Map Data

H1f0
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	78,912,412 - 78,914,704 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	78,912,650 - 78,914,704 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	79,028,212 - 79,030,504 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	79,028,450 - 79,030,504 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	78,858,642 - 78,860,934 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	78,855,467 - 78,857,759 (+)	NCBI		MGSCv36	mm8
Celera	15	81,129,838 - 81,132,130 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.7	NCBI

H1-0
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	37,805,229 - 37,807,432 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	37,805,229 - 37,807,432 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	38,201,236 - 38,203,439 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	36,531,060 - 36,533,389 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	36,525,673 - 36,527,943	NCBI
Celera	22	22,002,906 - 22,005,235 (+)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	21,168,152 - 21,170,440 (+)	NCBI		HuRef
CHM1_1	22	38,159,864 - 38,162,193 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	38,266,869 - 38,269,059 (+)	NCBI		T2T-CHM13v2.0

H1f0
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,473,280 - 112,475,140 (+)	NCBI		GRCr8
mRatBN7.2	7	110,592,834 - 110,594,694 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,592,208 - 110,594,694 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,342,360 - 112,344,218 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,565,891 - 114,567,749 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,534,630 - 114,536,489 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,260,776 - 120,262,636 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	120,252,161 - 120,254,021 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,001,334 - 117,003,194 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,035,563 - 117,037,417 (+)	NCBI
Celera	7	106,927,112 - 106,928,972 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

LOC102010789
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955413	24,182,547 - 24,184,588 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100970460
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	47,663,463 - 47,665,805 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	50,351,834 - 50,354,155 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	18,720,235 - 18,722,440 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	36,551,246 - 36,553,595 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	36,551,693 - 36,552,277 (+)	Ensembl	panpan1.1		panPan2

H1-0
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	26,827,748 - 26,829,909 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	26,829,089 - 26,829,673 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	26,782,473 - 26,784,681 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	27,619,090 - 27,621,274 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	27,619,090 - 27,621,395 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	27,342,278 - 27,344,472 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	27,650,729 - 27,652,916 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	27,827,947 - 27,830,156 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101970440
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	10,303,470 - 10,305,627 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	3,315,048 - 3,315,632 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	3,314,991 - 3,315,974 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

H1-0
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	10,038,966 - 10,041,067 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	10,038,944 - 10,041,242 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	7,534,689 - 7,536,892 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

H1-0
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	20,505,629 - 20,507,973 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	20,506,080 - 20,506,664 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	105,285,894 - 105,288,140 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101717518
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624752	10,103,866 - 10,105,983 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in H1f0
72 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	427
Count of miRNA genes:	302
Interacting mature miRNAs:	342
Transcripts:	ENSMUST00000180086
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
38501067	Tip3_m	tuberculosis immunophenotype 3, IFN-g level (mouse)					15	53563396	89584203	Mouse
1300627	Sluc26_m	susceptibility to lung cancer 26 (mouse)			Not determined		15	70345653	104073951	Mouse
27226777	Tibl8_m	tibia length 8, 5 week (mouse)					15	6929481	84584201	Mouse
15092079	Igly6_m	IgG glycosylation 6, GP6 (mouse)					15	74100540	82674156	Mouse
13504731	Cath5_m	carotid atherosclerosis 5 (mouse)					15	54789129	88789129	Mouse
1558786	Msq1_m	MAV-1 susceptibility QTL 1 (mouse)			Not determined		15	63389646	81086436	Mouse
15092080	Igly7_m	IgG glycosylation 7, GP10 (mouse)					15	77794919	82674156	Mouse
12791003	Aath8_m	aortic arch atherosclerosis 8 (mouse)					15	73430144	104073951	Mouse
1301006	Hfib1_m	hepatic fibrogenesis 1 (mouse)			Not determined		15	47306334	81306479	Mouse
27095936	Ulnl4_m	ulna length 4, 5 week (mouse)					15	56763396	87684201	Mouse
10755515	Amzn3_m	anatomical modifier of Zfp423 3 (mouse)					15	46389646	80389845	Mouse
1301171	Brm2_m	brachyury modifier 2 (mouse)			Not determined		15	65525376	99525499	Mouse
1301429	Pcir3_m	periosteal circumference 3 (mouse)			Not determined		15	48465362	82465496	Mouse
1302197	Bhr2_m	bronchial hyperresponsiveness 2 (mouse)			Not determined		15	64306334	103425899	Mouse
26884402	Cvht9_m	cranial vault height 9, 16 week (mouse)					15	42163396	95497881	Mouse
1357756	Alaa4_m	alopecia areata 4 (mouse)			Not determined		15	46389646	80389845	Mouse
1302074	Bmd4_m	bone mineral density 4 (mouse)			Not determined		15	56186708	103425899	Mouse
1301433	Rapop5_m	radiation-induced apoptosis 5 (mouse)			Not determined		15	9273022	79474762	Mouse
26884399	Humsd1_m	humerus midshaft diameter 1, 5 week (mouse)					15	48363396	101708435	Mouse
26884397	Humsd5_m	humerus midshaft diameter 5, 10 week (mouse)					15	48363396	98397881	Mouse
1300648	Dbsty4_m	diabesity 4 (mouse)			Not determined		15	70349271	104073951	Mouse
10412067	Pain2_m	pain 2 (mouse)			Not determined		15	51645339	85645626	Mouse
26884442	Sklq6_m	skull length QTL 6, 5 week (mouse)					15	6129481	100797881	Mouse
1357526	Hyplip2_m	hyperlipidemia 2 (mouse)			Not determined		15	12402203	102896555	Mouse
4142198	Hbtq_m	habituation QTL (mouse)			Not determined		15	51160708	85160833	Mouse
1357407	Pfat4_m	predicted fat percentage 4 (mouse)	8.6		Body fat amount	predicted fat percentage	15	57117005	91117153	Mouse
14928306	Manh79_m	mandible shape 79 (mouse)					15	78847557	104073951	Mouse
1357894	Epfpq3_m	epididymal fat percentage QTL 3 (mouse)			Not determined		15	78601103	102901704	Mouse
26884425	Cvht2_m	cranial vault height 2, 5 week (mouse)					15	28800146	102008435	Mouse
1302080	Szs13_m	seizure susceptibility 13 (mouse)			Not determined		15	51685832	85694449	Mouse
1300800	Ses3_m	salmonella enteritidis susceptibility 3 (mouse)			Not determined		15	57117005	91117153	Mouse
4142060	W3q6_m	weight 3 weeks QTL 6 (mouse)			Not determined			78601103	102901704	Mouse
10045637	Heal27_m	wound healing/regeneration 29 (mouse)			Not determined		15	51418361	85418511	Mouse
1558985	Eae32_m	experimental allergic encephalomyelitis susceptibility 32 (mouse)			Not determined		15	32578416	103425899	Mouse
4141921	Pstc3_m	periosteal circumference 3 (mouse)			Not determined		15	67270698	101270847	Mouse
1301708	Cocrb14_m	cocaine related behavior 14 (mouse)			Not determined		15	51806515	85806651	Mouse
12880411	V125Dq11_m	vitamin D active form serum level QTL 11 (mouse)					15	78897881	104073951	Mouse
12880420	V25Dq8_m	vitamin D inactive form serum level QTL 8 (mouse)					15	61584200	95584200	Mouse
1300851	Heal4_m	wound healing/regeneration 4 (mouse)			Not determined		15	77527592	104073951	Mouse
1302002	Cocia2_m	cocaine induced activation 2 (mouse)			Not determined		15	72372459	79899178	Mouse
14747011	Mancz13_m	mandible centroid size 13 (mouse)					15	72382669	104073951	Mouse
1300726	Pitm4_m	prion incubation time 4 (mouse)			Not determined		15	70349271	104073951	Mouse
1301119	Drb7_m	dopamine receptor binding 7 (mouse)			Not determined		15	65336578	99341028	Mouse
4141135	Cia35_m	collagen induced arthritis 35 (mouse)			Not determined		15	64811826	98811946	Mouse
27226734	Tibmd5_m	tibia midshaft diameter 5, 10 week (mouse)					15	6129481	86684201	Mouse
13442492	Mecth2_m	mechanosensation threshold 2 (mouse)					15	74662849	79387201	Mouse
1301601	Faq9_m	fluctuating asymmetry QTL 9 (mouse)			Not determined		15	63163903	97163995	Mouse
1301472	Pain1_m	pain 1 (mouse)			Not determined		15	75320846	90813185	Mouse
27226729	Tibmd2_m	tibia midshaft diameter 2, 5 week (mouse)					15	38000244	86684201	Mouse
1301860	Gct3_m	granulosa cell tumorigenesis 3 (mouse)			Not determined		15	47409596	81409691	Mouse

Markers in Region

U18295

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	79,029,477 - 79,029,639	UniSTS	GRCm38
MGSCv37	15	78,859,907 - 78,860,069	UniSTS	GRCm37
Celera	15	81,131,103 - 81,131,265	UniSTS
Cytogenetic Map	15	E1	UniSTS
cM Map	15	46.75	UniSTS
cM Map	15	46.6	UniSTS
Whitehead/MRC_RH	15	674.95	UniSTS

PMC164858P4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	79,028,632 - 79,029,493	UniSTS	GRCm38
MGSCv37	15	78,859,062 - 78,859,923	UniSTS	GRCm37
Celera	15	81,130,258 - 81,131,119	UniSTS
Cytogenetic Map	15	E1	UniSTS
cM Map	15	46.75	UniSTS

H1f0

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	79,029,452 - 79,029,692	UniSTS	GRCm38
MGSCv37	15	78,859,882 - 78,860,122	UniSTS	GRCm37
Celera	15	81,131,078 - 81,131,318	UniSTS
Cytogenetic Map	15	E1	UniSTS
cM Map	15	46.75	UniSTS

H1f0

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	15	79,028,686 - 79,029,365	UniSTS	GRCm38
MGSCv37	15	78,859,116 - 78,859,795	UniSTS	GRCm37
Celera	15	81,130,312 - 81,130,991	UniSTS
Cytogenetic Map	15	E1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_008197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI849476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK051213	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK052663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK077473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK090029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK145675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK146077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK153990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK155312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK177351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK186840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK195119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL589670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BB661016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003830	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC011493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC110361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M29260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U18295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X13171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X72894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000180086 ⟹ ENSMUSP00000137309

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	15	78,912,650 - 78,914,704 (+)	Ensembl
GRCm38.p6 Ensembl	15	79,028,450 - 79,030,504 (+)	Ensembl

RefSeq Acc Id:

NM_008197 ⟹ NP_032223

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	15	78,912,412 - 78,914,704 (+)	NCBI
GRCm38	15	79,028,212 - 79,030,504 (+)	ENTREZGENE
MGSCv37	15	78,858,642 - 78,860,934 (+)	RGD
Celera	15	81,129,838 - 81,132,130 (+)	RGD
cM Map	15		ENTREZGENE

Sequence:

show sequence

GGCGGCCGGGGCGCCAGGGTCCCCAGAAGGGAAGCCTAGGGAGCCGGGCAGAGACCTCGAGAGA
CGGCGGGCAGCGGGAAGGCCCGGGCCGCCGGGAAAGGTCGAGTTTGCTCGGCGGAAGAAACACA
GATGGCGGCAGCGCGGCGCCATTCCGGGCCGGGAGCAGGCAGCCAGCAGCCCAGTCCTCACCGC
GGTCCGCCCGCCGCCGCTAAATACCCGGATGCGCCGCCCGAGCGCCAGACGCAGAGCTGGGAAA
AGGGAGGCTGTGGAGGCGGAGGCAGCGCCAGGCGCCGGGCGAGCGACCGAACGGTGGGGGCTGG
GAGCGCAGAGCAGCTCGCGACCCGCGCCGGGAGGACAGGAGCCACGCGTAGCCCGCGTCCCCGG
CAGCCGCACTTGCGTCTGGCCTGCTAGTGGAGCGGGAGAGCAGATCGCGAGTCAGGTTCTGCAC
AGCCTCCGGCGAGGGCTGGCCCATCGGAAGGCTCCTTGAACAGTGGGAGCAGGCCGGCCACCAT
GACCGAGAACTCCACCTCCGCCCCGGCGGCGAAGCCCAAACGGGCCAAGGCTTCCAAGAAGTCC
ACGGACCACCCCAAGTATTCAGACATGATCGTGGCTGCTATCCAGGCAGAGAAGAACCGTGCCG
GCTCCTCGCGCCAGTCCATCCAAAAGTATATCAAGAGCCACTACAAGGTGGGTGAGAACGCCGA
CTCCCAGATCAAGTTGTCCATCAAGCGCCTAGTGACCACCGGTGTTCTCAAGCAAACCAAAGGG
GTGGGCGCCTCGGGGTCCTTCAGGCTGGCCAAGGGCGATGAGCCCAAAAGGTCGGTGGCTTTCA
AGAAGACCAAGAAGGAAGTCAAGAAAGTGGCCACTCCAAAGAAGGCAGCCAAGCCCAAGAAGGC
TGCCTCCAAAGCCCCAAGCAAGAAACCCAAAGCCACCCCTGTCAAGAAGGCCAAGAAGAAGCCG
GCTGCCACGCCCAAGAAAGCCAAAAAGCCCAAGGTTGTCAAAGTCAAACCAGTCAAGGCCTCCA
AACCCAAGAAGGCCAAAACCGTGAAGCCCAAAGCCAAGTCGAGTGCCAAGAGGGCCAGCAAGAA
GAAGTGAAGACTTTGCTTGGGGACACTCCTTCCTCCCTCCTGTTTTCTGTAAATACATTTCCTC
ACTTGATTCCATCTGCAACCCTTTGCCCATTCTATTCTGACTTTATTAAAGAGGACAGAGTTTG
GATCCCTCATACAGACATTGTGGAATGACTCCTTTTTCCTTAACCTATTGTGCAAGGACAGCAA
ACAGACCTCATCTTTGTAATGATGGAGACGTACTTTTTTCTTGATTTGATATTAACCTTCTTAC
GGGGTTAGGGATGGGAGGGGGGAGGATGTGTGTTTCAGTCGGTGGTTTGTTTACTATGAAGGAA
CTGGCAAAGTTCTGGCTAGGTGAGGGGACCCAGGAACTAAGGTTTGTCTTCCAAGACTTTCTTA
GACTGCTTGTCCCTCGTGAGCTTTTCAAAACCTTTGATGGGGAGCAGGTGACACCCCACCTAGC
TGGCCAAGGAGGGAGGGAAAATTCCCTGGGGCTGCCCTACCAACGGTGGTAAGTTGGAGACCTG
GTTGCTTTTTCTCTTCTGCCCTAGTGCCTCCCCATTGTCTAAAGGGGCAAAGGGGTCCAAGTGA
CAGCTGGTTAGAGAAGCCATAGCTTCTCACAACCAGGATCTAGCCATTGGGAAGGAGGGGTCTT
TTTCAGTAGTCTCTGGTTAAATGCGAGTGGACTTAGGGGGAGGGGTGGGTAATCAGCCAAGTGC
CTCAGTGTGCCTATGGAAACTTGGGTTTTTTCCACACGATTGATGGATTGCGTCCTAGCAGGAC
TTTGTACGTTTCCTTTCTTCCCTTTCCTGTGTAAGATGTGGCTTTGCTTGGTGCCGCTTCAGGT
CTACCAGCTGCCACTTAAAACCCTCCAACCTCTTTTACTCTTTGAGTTTTTTTTCTAAGTAGCG
GAGGAGGGGGAGAGGCAGGGAGTGGACTGTAAGACATACTCCAGTTGATTCGAATTTGCTAGGT
AGCTTTAGAGAGGCAGGATTGTGTGCATGTGTGTATATGTATATATCCATATCTAAGACTAGGA
CTTAGTCTCACTTCGGGAGCTGGGAGAAAAAAATCTGTACAGTTGTCTTTCTCTTATTTTAATA
AAATTAGAAACTCGCGCACCCTACCCCACCCCTTTTTAAACAAGTGTAACTAGTGCCCGGGAGA
AATTACTGTGGTTGTAATTTTAAAACTTTAAAATAAAACTGGAAAGGAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_032223	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA69911	(Get FASTA)	NCBI Sequence Viewer
	AAH03830	(Get FASTA)	NCBI Sequence Viewer
	AAH11493	(Get FASTA)	NCBI Sequence Viewer
	AAI10362	(Get FASTA)	NCBI Sequence Viewer
	AAO65499	(Get FASTA)	NCBI Sequence Viewer
	BAC34559	(Get FASTA)	NCBI Sequence Viewer
	BAC36817	(Get FASTA)	NCBI Sequence Viewer
	BAC41054	(Get FASTA)	NCBI Sequence Viewer
	BAE26583	(Get FASTA)	NCBI Sequence Viewer
	BAE26881	(Get FASTA)	NCBI Sequence Viewer
	BAE32300	(Get FASTA)	NCBI Sequence Viewer
	BAE33183	(Get FASTA)	NCBI Sequence Viewer
	CAA31569	(Get FASTA)	NCBI Sequence Viewer
	EDL04683	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000137309
	ENSMUSP00000137309.2
GenBank Protein	P10922	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_032223 ⟸ NM_008197
- UniProtKB:	Q3UKC0 (UniProtKB/Swiss-Prot), P10922 (UniProtKB/Swiss-Prot), Q3U4Y0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENA DSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRSVAFKKTKKEVKKVATPKKAAKPKK AASKAPSKKPKATPVKKAKKKPAATPKKAKKPKVVKVKPVKASKPKKAKTVKPKAKSSAKRASK KK hide sequence

Ensembl Acc Id:

ENSMUSP00000137309 ⟸ ENSMUST00000180086

Protein Domains

H15 Intercellular adhesion molecule N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P10922-F1-model_v2	AlphaFold	P10922	1-194	view protein structure

Promoters

RGD ID:

6826096

Promoter ID:

MM_KWN:19034

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000052097, NM_001161712, NM_008197, NM_013847

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	15	78,857,736 - 78,861,447 (+)	MPROMDB

RGD ID:

6849332

Promoter ID:

EP49009

Type:

single initiation site

Name:

MM_H10

Description:

Histone H1-0

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Notes:

homology_group=Homology group 222; Tetrapod histone H1 (0)

Experiment Methods:

Nuclease protection

Regulation:

S (repressed by or weakly expressed in) phase dependent

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv37	15	78,858,879 - 78,858,939	EPD
MGSCv36	15	78,858,879 - 78,858,939	EPD

RGD ID:

8684304

Promoter ID:

EPDNEW_M20183

Type:

initiation region

Name:

H1f0_1

Description:

Mus musculus H1 histone family, member 0 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	15	79,028,450 - 79,028,510	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:95893	AgrOrtholog
Ensembl Genes	ENSMUSG00000048769
	ENSMUSG00000096210	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000180086	ENTREZGENE
	ENSMUST00000180086.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Histone_H1/H5_H15	UniProtKB/Swiss-Prot
	Histone_H5	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:14958	UniProtKB/Swiss-Prot
MGD	MGI:95893	ENTREZGENE
NCBI Gene	14958	ENTREZGENE
PANTHER	HISTONE H1	UniProtKB/Swiss-Prot
	HISTONE H1.0	UniProtKB/Swiss-Prot
Pfam	Linker_histone	UniProtKB/Swiss-Prot
PhenoGen	H1f0	PhenoGen
PRINTS	HISTONEH5	UniProtKB/Swiss-Prot
PROSITE	H15	UniProtKB/Swiss-Prot
SMART	H15	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	H10_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q3U4Y0	ENTREZGENE, UniProtKB/TrEMBL
	Q3U5Y1_MOUSE	UniProtKB/TrEMBL
	Q3UKC0	ENTREZGENE
	Q8C1Y3_MOUSE	UniProtKB/TrEMBL
UniProt Secondary	Q3UKC0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-13	H1f0	H1.0 linker histone	H1f0	H1 histone family, member 0	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD