Fabp2 (fatty acid binding protein 2, intestinal)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fabp2 (fatty acid binding protein 2, intestinal) Mus musculus

Analyze

Symbol:

Fabp2

Name:

fatty acid binding protein 2, intestinal

RGD ID:

10564

MGI Page

MGI

Description:

Predicted to enable long-chain fatty acid binding activity and long-chain fatty acid transporter activity. Predicted to be involved in fatty acid metabolic process; intestinal lipid absorption; and long-chain fatty acid transport. Predicted to be located in apical cortex; microvillus; and plasma membrane. Predicted to be active in cytosol and nucleus. Is expressed in embryo endoderm; gut; liver and biliary system; and skeletal muscle. Human ortholog(s) of this gene implicated in alcoholic liver cirrhosis; carotid stenosis; coronary artery disease; end stage renal disease; and obesity. Orthologous to human FABP2 (fatty acid binding protein 2).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

Fa; Fabpi; fatty acid binding protein intestinal; fatty acid-binding protein 2; fatty acid-binding protein, intestinal; I-F; I-FABP; intestinal fatty acid binding protein 2; intestinal-type fatty acid-binding protein

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FABP2 (fatty acid binding protein 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Fabp2 (fatty acid binding protein 2)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Fabp2 (fatty acid binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FABP2 (fatty acid binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FABP2 (fatty acid binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fabp2 (fatty acid binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FABP2 (fatty acid binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FABP2 (fatty acid binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Fabp2 (fatty acid binding protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FABP2 (fatty acid binding protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fabp2 (fatty acid binding protein 2, intestinal)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	122,688,721 - 122,693,155 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	3	122,688,721 - 122,693,155 (+)	Ensembl
GRCm38	3	122,895,072 - 122,899,506 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	122,895,072 - 122,899,506 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	122,598,310 - 122,602,424 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	3	122,887,414 - 122,891,528 (+)	NCBI			mm8
Celera	3	129,305,754 - 129,309,868 (+)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	53.74	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcoholic liver cirrhosis (ISO)

carotid stenosis (ISO)

coronary artery disease (ISO)

Diabetic Nephropathies (ISO)

end stage renal disease (ISO)

Experimental Liver Cirrhosis (ISO)

Hypertriglyceridemia (ISO)

Insulin Resistance (ISO)

Metabolic Syndrome (ISO)

Neurodevelopmental Disorders (ISO)

obesity (ISO)

Stroke (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

1-naphthyl isothiocyanate (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4,6-trinitrotoluene (ISO)

2,4-dinitrotoluene (EXP,ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

aflatoxin M1 (ISO)

ammonium chloride (ISO)

benzo[a]pyrene (EXP,ISO)

bexarotene (ISO)

bezafibrate (EXP)

bis(2-ethylhexyl) phthalate (EXP)

captan (EXP)

carbon nanotube (EXP)

clofibrate (EXP)

copper(II) sulfate (ISO)

cyclosporin A (EXP)

decabromodiphenyl ether (ISO)

dichlorine (ISO)

diclofenac (EXP,ISO)

endosulfan (ISO)

ethanol (ISO)

fenofibrate (EXP)

ferroheme b (ISO)

folpet (EXP)

furan (ISO)

heme b (ISO)

iron atom (ISO)

iron(0) (ISO)

metformin (ISO)

microcystin-LR (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (ISO)

oleic acid (ISO)

ozone (ISO)

paracetamol (EXP)

perfluorohexanesulfonic acid (EXP)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (EXP)

phenobarbital (EXP,ISO)

pirinixic acid (EXP)

potassium dichromate (EXP)

pravastatin (EXP,ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propamocarb (EXP)

propiconazole (EXP)

rifaximin (ISO)

rotenone (ISO)

sodium dichromate (ISO)

tacrolimus hydrate (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (ISO)

troglitazone (ISO)

valproic acid (ISO)

vinclozolin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fatty acid metabolic process (ISO)

fatty acid transport (IBA,ISO)

intestinal absorption (ISO)

intestinal lipid absorption (ISO)

long-chain fatty acid transport (ISO)

Cellular Component

apical cortex (ISO)

cytoplasm (ISO)

cytosol (IBA)

microvillus (ISO)

nucleus (IBA)

plasma membrane (ISO)

Molecular Function

fatty acid binding (IBA,ISO)

lipid binding (IEA)

long-chain fatty acid binding (IBA,ISO)

long-chain fatty acid transporter activity (ISO)

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal circulating lipid level (IAGP)

decreased circulating cholesterol level (IAGP)

decreased circulating serum albumin level (IEA)

decreased circulating total protein level (IEA)

decreased liver weight (IAGP)

decreased susceptibility to diet-induced obesity (IAGP)

decreased uterine fat pad weight (IAGP)

enlarged lymph nodes (IEA)

increased circulating glycerol level (IAGP)

increased circulating insulin level (IAGP)

increased circulating leptin level (IAGP)

increased epididymal fat pad weight (IAGP)

increased kidney weight (IAGP)

increased liver weight (IAGP)

increased susceptibility to diet-induced obesity (IAGP)

shortened PR interval (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Intestinal FABP2 A54T polymorphism: association with insulin resistance and obesity in women.	Albala C, etal., Obes Res. 2004 Feb;12(2):340-5.
2.	Cloning of a cDNA encoding rat intestinal fatty acid binding protein.	Alpers DH, etal., Proc Natl Acad Sci U S A 1984 Jan;81(2):313-7.
3.	An amino acid substitution in the human intestinal fatty acid binding protein is associated with increased fatty acid binding, increased fat oxidation, and insulin resistance.	Baier LJ, etal., J Clin Invest 1995 Mar;95(3):1281-7.
4.	The fatty acid-binding protein-2 A54T polymorphism is associated with renal disease in patients with type 2 diabetes.	Canani LH, etal., Diabetes. 2005 Nov;54(11):3326-30.
5.	The T 54 allele of the intestinal fatty acid-binding protein 2 is associated with a parental history of stroke.	Carlsson M, etal., J Clin Endocrinol Metab 2000 Aug;85(8):2801-4.
6.	Codon-54 polymorphism of the fatty acid-binding protein 2 gene is associated with elevation of fasting and postprandial triglyceride in type 2 diabetes.	Georgopoulos A, etal., J Clin Endocrinol Metab 2000 Sep;85(9):3155-60.
7.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
8.	Comparison of the acute response to meals enriched with cis- or trans-fatty acids on glucose and lipids in overweight individuals with differing FABP2 genotypes.	Lefevre M, etal., Metabolism. 2005 Dec;54(12):1652-8.
9.	Electronic Transfer of Homolog Data	MGD and Homologene mouse data transfer
10.	MGDs mouse GO annotations	MGD data from the GO Consortium
11.	MGD IEA	MGD IEA
12.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
13.	Lack of association between the fatty acid binding protein 2 (FABP2) polymorphism with obesity and insulin resistance in two aboriginal populations from Chile.	Perez-Bravo F, etal., Acta Diabetol. 2006 Dec;43(4):93-8.
14.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
15.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
17.	The role of FABP2 gene polymorphism in alcoholic cirrhosis.	Salguero ML, etal., Hepatol Res. 2005 Nov 8;.
18.	The human and rodent intestinal fatty acid binding protein genes. A comparative analysis of their structure, expression, and linkage relationships.	Sweetser DA, etal., J Biol Chem 1987 Nov 25;262(33):16060-71.
19.	Thr54 allele of the FABP2 gene affects resting metabolic rate and visceral obesity.	Takakura Y, etal., Diabetes Res Clin Pract. 2005 Jan;67(1):36-42.
20.	Thr54 allele carriers of the Ala54Thr variant of FABP2 gene have associations with metabolic syndrome and hypertriglyceridemia in urban South Indians.	Vimaleswaran KS, etal., Metabolism. 2006 Sep;55(9):1222-6.
21.	Genetic variation of the intestinal fatty acid-binding protein 2 gene in carotid atherosclerosis.	Wanby P, etal., Vasc Med. 2005 May;10(2):103-8.
22.	Genetic risk for coronary artery disease in individuals with or without type 2 diabetes.	Yamada Y, etal., Mol Genet Metab. 2004 Apr;81(4):282-90.

Additional References at PubMed

PMID:1527171	PMID:1617215	PMID:1739433	PMID:9203584	PMID:9277406	PMID:9494081	PMID:10349636	PMID:10608876	PMID:10725233	PMID:10786634	PMID:11023988	PMID:11042159
PMID:11076861	PMID:11584097	PMID:11707574	PMID:11757913	PMID:12477932	PMID:15060137	PMID:15306695	PMID:15489334	PMID:15590741	PMID:15604097	PMID:15809042	PMID:16141072
PMID:16141073	PMID:16882015	PMID:17485926	PMID:17905650	PMID:17983586	PMID:18186922	PMID:18369314	PMID:18653563	PMID:19389805	PMID:19801644	PMID:20015616	PMID:20043902
PMID:20637749	PMID:20883684	PMID:21267068	PMID:21677750	PMID:21873635	PMID:22015720	PMID:22026722	PMID:22425624	PMID:22584290	PMID:22666383	PMID:22766025	PMID:23676500
PMID:23990461	PMID:24496623	PMID:24929016	PMID:25122651	PMID:29684311	PMID:31345929	PMID:31905021	PMID:32298508

Genomics

Comparative Map Data

Fabp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	122,688,721 - 122,693,155 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	3	122,688,721 - 122,693,155 (+)	Ensembl
GRCm38	3	122,895,072 - 122,899,506 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	122,895,072 - 122,899,506 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	122,598,310 - 122,602,424 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	3	122,887,414 - 122,891,528 (+)	NCBI			mm8
Celera	3	129,305,754 - 129,309,868 (+)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	53.74	NCBI

FABP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	119,317,250 - 119,322,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	119,317,250 - 119,322,138 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	120,238,405 - 120,243,293 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	120,457,853 - 120,462,766 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	4	120,596,008 - 120,600,921	NCBI
Celera	4	117,600,001 - 117,604,911 (-)	NCBI
Cytogenetic Map	4	q26	NCBI
HuRef	4	115,960,235 - 115,965,143 (-)	NCBI		HuRef
CHM1_1	4	120,214,972 - 120,219,883 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	122,622,352 - 122,627,246 (-)	NCBI

Fabp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	211,040,032 - 211,044,089 (+)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	2	211,040,032 - 211,044,089 (+)	Ensembl
Rnor_6.0	2	227,080,912 - 227,083,654 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	227,080,924 - 227,083,501 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	246,442,292 - 246,445,034 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	219,591,502 - 219,605,097 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	2	219,554,563 - 219,568,159 (+)	NCBI
Celera	2	203,465,826 - 203,473,400 (+)	NCBI		Celera
RH 3.4 Map	2	1537.1	RGD
Cytogenetic Map	2	q42	NCBI

Fabp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	20,930,479 - 20,933,950 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955428	20,930,512 - 20,933,950 (+)	NCBI	ChiLan1.0	ChiLan1.0

FABP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	4	122,055,544 - 122,060,461 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	122,055,544 - 122,060,461 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	4	111,505,269 - 111,510,197 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

FABP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	38,244,065 - 38,248,093 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
ROS_Cfam_1.0	32	38,465,352 - 38,497,153 (-)	NCBI
ROS_Cfam_1.0 Ensembl	32	38,465,346 - 38,492,684 (-)	Ensembl

Fabp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	67,281,463 - 67,284,661 (+)	NCBI
SpeTri2.0	NW_004936869	146,567 - 149,929 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FABP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	104,464,342 - 104,470,480 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	104,464,342 - 104,468,059 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	112,120,922 - 112,124,639 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FABP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	66,797,832 - 66,803,459 (-)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	7	66,798,990 - 66,802,738 (-)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666037	45,658,385 - 45,663,315 (-)	NCBI	Vero_WHO_p1.0

Position Markers

Fabp2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	122,899,280 - 122,899,405	UniSTS	GRCm38
MGSCv37	3	122,602,198 - 122,602,323	UniSTS	GRCm37
Celera	3	129,309,642 - 129,309,767	UniSTS
Cytogenetic Map	3	G1	UniSTS
cM Map	3	55.0	UniSTS

M65034

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	122,899,339 - 122,899,504	UniSTS	GRCm38
MGSCv37	3	122,602,257 - 122,602,422	UniSTS	GRCm37
Celera	3	129,309,701 - 129,309,866	UniSTS
Cytogenetic Map	3	G1	UniSTS
cM Map	3	55.0	UniSTS
Whitehead_YAC	3		UniSTS

D3Mit108

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	122,898,771 - 122,899,085	UniSTS	GRCm38
MGSCv37	3	122,601,689 - 122,602,003	UniSTS	GRCm37
Celera	3	129,309,133 - 129,309,447	UniSTS
Cytogenetic Map	3	G1	UniSTS
cM Map	3	58.5	UniSTS
Whitehead Genetic	3	41.5	UniSTS

D3Mit108.1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	122,898,686 - 122,898,809	UniSTS	GRCm38
MGSCv37	3	122,601,604 - 122,601,727	UniSTS	GRCm37
Celera	3	129,309,048 - 129,309,171	UniSTS
Cytogenetic Map	3	G1	UniSTS
cM Map	3	58.5	UniSTS
cM Map	3		UniSTS
Whitehead Genetic	3	41.5	UniSTS
Whitehead_YAC	3		UniSTS

Fabp2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	3	G1	UniSTS

Fabp2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	3	122,898,758 - 122,899,404	UniSTS	GRCm38
MGSCv37	3	122,601,676 - 122,602,322	UniSTS	GRCm37
Celera	3	129,309,120 - 129,309,766	UniSTS
Cytogenetic Map	3	G1	UniSTS
cM Map	3	55.0	UniSTS

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
26884436	Zlq3_m	zygomatic length QTL 3, 10 week (mouse)					3	3265060	142405761	Mouse
13207570	Tcq12_m	total cholesterol QTL 12 (mouse)					3	16504164	130163649	Mouse
1302056	Orgwq4_m	organ weight QTL 4 (mouse)			Not determined		3	30067588	147304689	Mouse
1301705	Sles3_m	systemic lupus erythmatosus suppressor 3 (mouse)			Not determined		3	37174862	143353183	Mouse
26884382	Bzwq1_m	bi-zygomatic width QTL 1, 5 week (mouse)					3	52207421	137205761	Mouse
25314313	Syncl1_m	synaptonemal complex length 1 (mouse)					3	67907333	128393649	Mouse
1357583	Sle18_m	systematic lupus erythematosus susceptibility 18 (mouse)			Not determined		3	87208904	125316236	Mouse
4142178	Ctrq2_m	C. trachomatis resistance QTL 2 (mouse)			Not determined		3	89139967	137453008	Mouse
10766455	Sle22_m	systematic lupus erythematosus susceptibility 22 (mouse)					3	90376936	124377072	Mouse
14747001	Mancz4_m	mandible centroid size 4 (mouse)					3	90378017	124378017	Mouse
1302052	Etohcta4_m	ethanol conditioned taste aversion 4 (mouse)			Not determined		3	91000105	125008748	Mouse
1301349	Pgia26_m	proteoglycan induced arthritis 26 (mouse)			Not determined		3	92251533	126251650	Mouse
27226732	Tibmd3_m	tibia midshaft diameter 3, 10 week (mouse)					3	96607316	147805636	Mouse
10043955	Wt10q4_m	body weight, 10 weeks, QTL 4 (mouse)			Not determined		3	98624041	132624197	Mouse
11533920	Mvb3_m	modifier of vibrator 3 (mouse)					3	98635284	132635383	Mouse
12792984	Modn1_m	modifier of Dstn neovascularization 1 (mouse)					3	98635284	132635383	Mouse
1302114	Tbs1_m	tuberculosis severity 1 (mouse)			Not determined		3	98924105	132924250	Mouse
1300752	Ap6q_m	alcohol preference 6 QTL (mouse)			Not determined		3	100372912	147045722	Mouse
26884419	Bzwq6_m	bi-zygomatic width QTL 6, 10 week (mouse)					3	100607316	137205761	Mouse
27226733	Tibmd6_m	tibia midshaft diameter 6, 16 week (mouse)					3	101307316	149805637	Mouse
1301805	Mors2_m	modifier of obesity related sterility 2 (mouse)			Not determined		3	103482659	137482783	Mouse
8655599	Cia5c_m	collagen induced arthritis QTL 5c (mouse)			Not determined		3	107376936	125316237	Mouse
1302093	Orgwq5_m	organ weight QTL 5 (mouse)			Not determined		3	107376936	147304689	Mouse
1300619	Cdcs1_m	cytokine deficiency colitis susceptibility 1 (mouse)			Not determined		3	109834882	143835005	Mouse
12910793	Pwbwq7_m	post-weaning body weight QTL 7 (mouse)					3	110084357	135715812	Mouse
12910796	Pwbwq6_m	post-weaning body weight QTL 6 (mouse)					3	110084357	135715812	Mouse
12910815	Ogrq1_m	overall growth rate QTL 1 (mouse)					3	110084357	135715812	Mouse
1301381	Bomb1_m	bone marrow pre-B 1 (mouse)			Not determined		3	111133243	145133417	Mouse
1301100	Bdt2_m	bone density traits 2 (mouse)			Not determined		3	114736617	148736784	Mouse
10043919	Afpq8_m	abdominal fat percent QTL 8 (mouse)			Not determined		3	119057332	153057456	Mouse
1558868	Ses9_m	salmonella enteritidis susceptibility 9 (mouse)			Not determined		3	119057332	153057456	Mouse
4141935	Tgq15_m	triglyceride QTL 15 (mouse)			Not determined			119318586	153318586	Mouse
4142449	Tgq14_m	triglyceride QTL 14 (mouse)			Not determined			119318586	153318586	Mouse
1302151	Lprm2_m	lymphoproliferation modifier 2 (mouse)			Not determined		3	119778857	153779044	Mouse
10412240	Alpq6_m	alcohol preference QTL 6 (mouse)			Not determined		3	120772078	154772078	Mouse
12903998	Cfq3_m	conditioned fear QTL 3 (mouse)					3	122188811	127220016	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	73
Count of miRNA genes:	71
Interacting mature miRNAs:	72
Transcripts:	ENSMUST00000023820
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_007980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA245078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC155158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK007995	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY523818	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY523819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC013457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY707992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M65033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M65034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000023820 ⟹ ENSMUSP00000023820

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	3	122,688,721 - 122,693,155 (+)	Ensembl
GRCm38.p6 Ensembl	3	122,895,072 - 122,899,506 (+)	Ensembl

RefSeq Acc Id:

NM_007980 ⟹ NP_032006

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	3	122,688,721 - 122,693,155 (+)	NCBI
GRCm38	3	122,895,072 - 122,899,506 (+)	NCBI
MGSCv37	3	122,598,310 - 122,602,424 (+)	RGD
Celera	3	129,305,434 - 129,309,868 (+)	NCBI
cM Map	3		ENTREZGENE

Sequence:

show sequence

CTTAGAACTGGCTGCCTCTGCCTCCGGAGAGCAGCGATTAAAAGTGTCAGCCATCATTACCTGG
CCCTAATTCTTGAAATAAAAATGCCCACATGCTGTAGTTGAAGGCAGAGTAGGAATGATTATCA
GATTTTAATTCAGTTGAATCCCAGCAGTAGATTCAAAGAAAGCATGGGAAGAGAAACCAAAGGG
GCCTGGCATGTGAGGCGGTTAGGTTATCTCCTGAACTTCGAACTTCCACATCACAGTATGAATT
GGTTCGAAGATAAGAAATAGAATAAATTCTCTCTAGTGGACAGGACTGGACCTCTGCTTTCCTA
GAGACACACACAGCTGAGATCATGGCATTCGACGGCACGTGGAAAGTAGACCGGAACGAGAACT
ATGAAAAGTTCATGGAGAAAATGGGCATTAATGTGATGAAGAGGAAGCTTGGAGCTCATGACAA
TCTGAAACTGACAATCACACAGGATGGAAATAAATTCACAGTCAAAGAATCAAGCAACTTCAGA
AACATTGATGTTGTGTTTGAGCTCGGTGTAAACTTTCCCTACAGTCTAGCAGACGGAACGGAGC
TCACTGGGGCCTGGACCATTGAGGGAAATAAACTTATTGGGAAATTCACACGTGTAGACAATGG
AAAGGAGCTGATTGCTGTCCGAGAGGTTTCTGGTAATGAACTAATCCAGACCTACACATATGAA
GGAGTTGAGGCCAAGCGATTCTTTAAGAAGGAATAAGTCAACTTCTCAGAGCCTGGAGCAACGC
TGAAGAGCTAAGCTGATGTCAGATTTCTTTCTCCATCATGCTAATGCCAGGCTCATTCGTCATC
CTATCAGCACTGGTCTCCAGCCTTGTCAAAGCTAAAGAAGTAAAAGCTAATTAAAAGAACTTCA
TTTGTTTTATGATCCTTAAGCTATACATGAACTAGTCTTTTAAAAGAAAATAAATCCTGTTCTC
ACACAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_032006	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA37589	(Get FASTA)	NCBI Sequence Viewer
	AAH13457	(Get FASTA)	NCBI Sequence Viewer
	AAS00549	(Get FASTA)	NCBI Sequence Viewer
	AAS00550	(Get FASTA)	NCBI Sequence Viewer
	BAB25397	(Get FASTA)	NCBI Sequence Viewer
	EDL12315	(Get FASTA)	NCBI Sequence Viewer
	P55050	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_032006 ⟸ NM_007980
- UniProtKB:	P55050 (UniProtKB/Swiss-Prot), Q53YP5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAFDGTWKVDRNENYEKFMEKMGINVMKRKLGAHDNLKLTITQDGNKFTVKESSNFRNIDVVFE LGVNFPYSLADGTELTGAWTIEGNKLIGKFTRVDNGKELIAVREVSGNELIQTYTYEGVEAKRF FKKE hide sequence

RefSeq Acc Id:

ENSMUSP00000023820 ⟸ ENSMUST00000023820

Protein Domains

FABP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P55050-F1-model_v2	AlphaFold	P55050	1-132	view protein structure

Promoters

RGD ID:

6849634

Promoter ID:

EP41010

Type:

single initiation site

Name:

MM_FABI

Description:

Intestinal fatty-acid binding protein, FABP2 or FABPI gene.

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Tissues & Cell Lines:

gut

Experiment Methods:

Primer extension with homologous sequence ladder

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv37	3	122,598,296 - 122,598,356	EPD
MGSCv36	3	122,598,296 - 122,598,356	EPD

RGD ID:

6882264

Promoter ID:

EPDNEW_M4583

Type:

multiple initiation site

Name:

Fabp2_1

Description:

Mus musculus fatty acid binding protein 2, intestinal , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	3	122,895,377 - 122,895,437	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:95478	AgrOrtholog
Ensembl Genes	ENSMUSG00000023057	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000023820	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000023820	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FABP2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fatty_acid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:14079	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:95478	ENTREZGENE
NCBI Gene	14079	ENTREZGENE
PANTHER	PTHR11955	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11955:SF89	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Lipocalin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fabp2	PhenoGen
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	FABPI_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q53YP5	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype