Send us a Message
Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   
Search RGD Grant Resources Citing RGD About Us Contact Us
Genes Variants Community Projects QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data
OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer)
Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease
Find Models Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive
Pathways
Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
Advanced Search (OLGA)

EXPERIMENTAL CONDITION - ANNOTATIONS

The Clinical Measurement Ontology (CMO), Measurement Methods Ontology (MMO), and Experimental Condition Ontology (XCO) are currently being developed at the Rat Genome Database. For more information about these vocabularies please see Shimoyama et al. Three ontologies to define phenotype measurement data. Front Genet. 2012;3:87. Epub 2012 May 28 or contact us (http://rgd.mcw.edu/contact/index.shtml).
Term:lixisenatide
go back to main search page
Accession:XCO:0001209 term browser browse the term
Definition:This is any condition in which the main influencing factor is lixisenatide, a 44 amino acid polypeptide and glucagon-like peptide 1 receptor agonist used as an adjunct to diet and exercise for the treatment of adults with type II diabetes.
Synonyms:exact_synonym: H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2
 xref: CID:90472060;   PMID:37423944


show annotations for term's descendants           Sort by:
Term paths to the root
Path 1
Term Annotations click to browse term
  experimental condition 2376
    therapeutic agent 101
      hypoglycemic agent 0
        lixisenatide 0
Path 2
Term Annotations click to browse term
  experimental condition 2376
    chemical 1266
      chemical with specified function 517
        activator 1
          receptor agonist 1
            lixisenatide 0
paths to the root