Send us a Message
Submit Data |  Help |  Video Tutorials |  News |  Publications |  Download |  REST API |  Citing RGD |  Contact   
Search RGD Grant Resources Citing RGD About Us Contact Us
Genes Variants Community Projects QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data
OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer)
Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease
Find Models Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive
Pathways
Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
Advanced Search (OLGA)

CHEBI ONTOLOGY - ANNOTATIONS

The Chemical Entities of Biological Interest (ChEBI) ontology is downloaded weekly from EMBL-EBI at http://www.ebi.ac.uk/chebi/. The data is made available under the Creative Commons License (CC BY 3.0, http://creativecommons.org/licenses/by/3.0/). For more information see: Degtyarenko et al. (2008) ChEBI: a database and ontology for chemical entities of biological interest. Nucleic Acids Res. 36, D344–D350.
Term:polypeptide
go back to main search page
Accession:CHEBI:15841 term browser browse the term
Definition:A peptide containing ten or more amino acid residues.
Synonyms:exact_synonym: polypeptides
 related_synonym: Formula=C4H6N2O3R2(C2H2NOR)n;   Polypeptid;   polipeptido
 alt_id: CHEBI:14860;   CHEBI:8314
 xref: KEGG:C00403


show annotations for term's descendants           Sort by:
afamelanotide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Mc4r melanocortin 4 receptor increases activity ISO MSH, 4-Nle-7-Phe-alpha- results in increased activity of MC4R protein CTD PMID:17713970 NCBI chr18:60,419,832...60,421,719
Ensembl chr18:60,419,832...60,421,719 		JBrowse link
Ampullosporin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Adam24 ADAM metallopeptidase domain 24 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of ADAM24 mRNA CTD PMID:16635253 NCBI chr16:51,578,278...51,584,265
Ensembl chr16:51,578,277...51,584,312 		JBrowse link
G Adcyap1 adenylate cyclase activating polypeptide 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of ADCYAP1 mRNA CTD PMID:16635253 NCBI chr 9:113,102,632...113,122,500
Ensembl chr 9:113,103,718...113,109,773 		JBrowse link
G Agt angiotensinogen multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of AGT mRNA CTD PMID:16635253 NCBI chr19:52,529,139...52,549,618
Ensembl chr19:52,529,185...52,540,977 		JBrowse link
G Alas1 5'-aminolevulinate synthase 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of ALAS1 mRNA CTD PMID:16635253 NCBI chr 8:106,876,514...106,889,917
Ensembl chr 8:106,876,514...106,889,917 		JBrowse link
G Alpl alkaline phosphatase, biomineralization associated multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of ALPL mRNA CTD PMID:16635253 NCBI chr 5:149,951,397...150,006,424
Ensembl chr 5:149,951,409...150,006,446 		JBrowse link
G Amhr2 anti-Mullerian hormone receptor type 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of AMHR2 mRNA CTD PMID:16635253 NCBI chr 7:133,579,152...133,588,874
Ensembl chr 7:133,579,393...133,588,258 		JBrowse link
G Anxa5 annexin A5 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of ANXA5 mRNA CTD PMID:16635253 NCBI chr 2:119,314,007...119,344,703
Ensembl chr 2:119,314,007...119,353,369 		JBrowse link
G Arf3 ADP-ribosylation factor 3 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of ARF3 mRNA CTD PMID:16635253 NCBI chr 7:129,886,082...129,912,022
Ensembl chr 7:129,886,082...129,912,002 		JBrowse link
G Btg1 BTG anti-proliferation factor 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of BTG1 mRNA CTD PMID:16635253 NCBI chr 7:31,341,391...31,343,649
Ensembl chr 7:31,341,027...31,343,649 		JBrowse link
G Calb2 calbindin 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CALB2 mRNA CTD PMID:16635253 NCBI chr19:38,114,435...38,141,438
Ensembl chr19:38,114,424...38,141,438 		JBrowse link
G Camkk2 calcium/calmodulin-dependent protein kinase kinase 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CAMKK2 mRNA CTD PMID:16635253 NCBI chr12:33,791,023...33,845,000
Ensembl chr12:33,791,052...33,843,279 		JBrowse link
G Car8 carbonic anhydrase 8 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CAR8 mRNA CTD PMID:16635253 NCBI chr 5:21,302,940...21,402,395
Ensembl chr 5:21,305,383...21,402,374 		JBrowse link
G Cck cholecystokinin multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of CCK mRNA CTD PMID:16635253 NCBI chr 8:121,153,499...121,160,194
Ensembl chr 8:121,153,500...121,160,084 		JBrowse link
G Cd63 Cd63 molecule multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CD63 mRNA CTD PMID:16635253 NCBI chr 7:1,325,108...1,340,447
Ensembl chr 7:1,325,103...1,399,178 		JBrowse link
G Cdh15 cadherin 15 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CDH15 mRNA CTD PMID:16635253 NCBI chr19:50,903,757...50,927,151
Ensembl chr19:50,903,638...50,927,105 		JBrowse link
G Chd7 chromodomain helicase DNA binding protein 7 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CHD7 mRNA CTD PMID:16635253 NCBI chr 5:21,812,007...21,995,358
Ensembl chr 5:21,812,070...21,995,358 		JBrowse link
G Cited2 Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CITED2 mRNA CTD PMID:16635253 NCBI chr 1:12,312,426...12,314,869
Ensembl chr 1:12,312,160...12,314,897 		JBrowse link
G Col18a1 collagen type XVIII alpha 1 chain multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of COL18A1 mRNA CTD PMID:16635253 NCBI chr20:11,474,104...11,582,593
Ensembl chr20:11,474,104...11,582,593 		JBrowse link
G Csrp2 cysteine and glycine-rich protein 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of CSRP2 mRNA CTD PMID:16635253 NCBI chr 7:46,349,109...46,367,743
Ensembl chr 7:46,348,686...46,367,745 		JBrowse link
G Cyfip2 cytoplasmic FMR1 interacting protein 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of CYFIP2 mRNA CTD PMID:16635253 NCBI chr10:30,621,318...30,741,113
Ensembl chr10:30,621,318...30,741,113 		JBrowse link
G Dao D-amino-acid oxidase multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of DAO mRNA CTD PMID:16635253 NCBI chr12:42,592,342...42,613,046
Ensembl chr12:42,592,343...42,612,741 		JBrowse link
G Dgkg diacylglycerol kinase, gamma multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of DGKG mRNA CTD PMID:16635253 NCBI chr11:78,384,212...78,579,158
Ensembl chr11:78,384,458...78,577,212 		JBrowse link
G Dusp5 dual specificity phosphatase 5 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of CPG21 mRNA CTD PMID:16635253 NCBI chr 1:252,538,408...252,555,320
Ensembl chr 1:252,538,449...252,551,818 		JBrowse link
G Fat1 FAT atypical cadherin 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of FAT1 mRNA CTD PMID:16635253 NCBI chr16:47,177,253...47,296,261
Ensembl chr16:47,177,248...47,296,107 		JBrowse link
G Fxyd1 FXYD domain-containing ion transport regulator 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of FXYD1 mRNA CTD PMID:16635253 NCBI chr 1:86,287,163...86,291,478
Ensembl chr 1:86,287,165...86,291,278 		JBrowse link
G Gabra6 gamma-aminobutyric acid type A receptor subunit alpha6 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of GABRA6 mRNA CTD PMID:16635253 NCBI chr10:26,810,411...26,825,768
Ensembl chr10:26,810,423...26,825,769 		JBrowse link
G Gabrd gamma-aminobutyric acid type A receptor subunit delta multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of GABRD mRNA CTD PMID:16635253 NCBI chr 5:165,958,508...165,970,407
Ensembl chr 5:165,958,484...165,970,411 		JBrowse link
G Gfra2 GDNF family receptor alpha 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of GFRA2 mRNA CTD PMID:16635253 NCBI chr15:45,941,841...46,033,715
Ensembl chr15:45,941,828...46,033,714 		JBrowse link
G Grid2 glutamate ionotropic receptor delta type subunit 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of GRID2 mRNA CTD PMID:16635253 NCBI chr 4:92,415,019...93,892,472
Ensembl chr 4:92,415,230...93,889,355 		JBrowse link
G Grm1 glutamate metabotropic receptor 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of GRM1 mRNA CTD PMID:16635253 NCBI chr 1:5,058,285...5,453,170
Ensembl chr 1:5,058,292...5,453,170 		JBrowse link
G Grm4 glutamate metabotropic receptor 4 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of GRM4 mRNA CTD PMID:16635253 NCBI chr20:5,484,172...5,572,821
Ensembl chr20:5,481,124...5,572,821 		JBrowse link
G H1f0 H1.0 linker histone multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of H1F0 mRNA CTD PMID:16635253 NCBI chr 7:110,592,834...110,594,694
Ensembl chr 7:110,592,208...110,594,694 		JBrowse link
G H1f4 H1.4 linker histone, cluster member multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of H1F4 mRNA CTD PMID:16635253 NCBI chr17:41,486,574...41,487,355
Ensembl chr17:41,486,560...41,487,403 		JBrowse link
G Hpcal1 hippocalcin-like 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of HPCAL1 mRNA CTD PMID:16635253 NCBI chr 6:40,478,206...40,584,721
Ensembl chr 6:40,478,208...40,584,687 		JBrowse link
G Igf2 insulin-like growth factor 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of IGF2 mRNA CTD PMID:16635253 NCBI chr 1:197,814,409...197,831,802
Ensembl chr 1:197,814,410...197,823,018 		JBrowse link
G Igfbp2 insulin-like growth factor binding protein 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of IGFBP2 mRNA CTD PMID:16635253 NCBI chr 9:74,415,574...74,442,945
Ensembl chr 9:74,415,546...74,442,937 		JBrowse link
G Kcnc1 potassium voltage-gated channel subfamily C member 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of KCNC1 mRNA CTD PMID:16635253 NCBI chr 1:96,902,953...96,944,744
Ensembl chr 1:96,902,953...96,944,744 		JBrowse link
G Kcnj12 potassium inwardly-rectifying channel, subfamily J, member 12 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of KCNJ12 mRNA CTD PMID:16635253 NCBI chr10:45,696,621...45,745,528
Ensembl chr10:45,696,849...45,745,492 		JBrowse link
G Kcnmb4 potassium calcium-activated channel subfamily M regulatory beta subunit 4 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of KCNMB4 mRNA CTD PMID:16635253 NCBI chr 7:52,066,145...52,119,098
Ensembl chr 7:52,066,136...52,119,278 		JBrowse link
G Kif13a kinesin family member 13A multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of KIF13A mRNA CTD PMID:16635253 NCBI chr17:17,766,597...17,948,517
Ensembl chr17:17,766,597...17,943,615 		JBrowse link
G Kifc2 kinesin family member C2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of KIFC2 mRNA CTD PMID:16635253 NCBI chr 7:108,380,634...108,388,364
Ensembl chr 7:108,376,011...108,388,484 		JBrowse link
G Klk6 kallikrein related-peptidase 6 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of KLK6 mRNA CTD PMID:16635253 NCBI chr 1:94,278,863...94,286,136
Ensembl chr 1:94,280,340...94,286,121 		JBrowse link
G Lgals1 galectin 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of LGALS1 mRNA CTD PMID:16635253 NCBI chr 7:110,485,239...110,488,345
Ensembl chr 7:110,481,392...110,488,345 		JBrowse link
G Lzts1 leucine zipper tumor suppressor 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of LZTS1 mRNA CTD PMID:16635253 NCBI chr16:20,542,756...20,598,204
Ensembl chr16:20,542,809...20,598,203 		JBrowse link
G Mab21l2 mab-21 like 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of MAB21L2 mRNA CTD PMID:16635253 NCBI chr 2:171,946,573...171,949,655
Ensembl chr 2:171,946,573...171,949,655 		JBrowse link
G Nefh neurofilament heavy chain multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of NEFH mRNA CTD PMID:16635253 NCBI chr14:79,830,362...79,840,347
Ensembl chr14:79,830,362...79,840,351 		JBrowse link
G Neurod1 neuronal differentiation 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of NEUROD1 mRNA CTD PMID:16635253 NCBI chr 3:64,359,554...64,363,526
Ensembl chr 3:64,359,395...64,363,649 		JBrowse link
G Nrep neuronal regeneration related protein multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of NREP mRNA CTD PMID:16635253 NCBI chr18:25,017,069...25,046,593
Ensembl chr18:25,017,083...25,046,591 		JBrowse link
G Nsmf NMDA receptor synaptonuclear signaling and neuronal migration factor multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of NSMF mRNA CTD PMID:16635253 NCBI chr 3:7,861,846...7,870,615
Ensembl chr 3:7,861,872...7,870,614 		JBrowse link
G Patj PATJ, crumbs cell polarity complex component multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PATJ mRNA CTD PMID:16635253 NCBI chr 5:113,061,985...113,364,807
Ensembl chr 5:113,062,118...113,364,807 		JBrowse link
G Pcsk6 proprotein convertase subtilisin/kexin type 6 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PCSK6 mRNA CTD PMID:16635253 NCBI chr 1:119,428,978...119,627,626
Ensembl chr 1:119,429,265...119,627,596 		JBrowse link
G Pde2a phosphodiesterase 2A multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of PDE2A mRNA CTD PMID:16635253 NCBI chr 1:155,823,590...155,915,434
Ensembl chr 1:155,813,180...155,915,434 		JBrowse link
G Per2 period circadian regulator 2 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of PER2 mRNA CTD PMID:16635253 NCBI chr 9:92,007,289...92,049,551
Ensembl chr 9:92,007,296...92,049,459 		JBrowse link
G Pex6 peroxisomal biogenesis factor 6 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PEX6 mRNA CTD PMID:16635253 NCBI chr 9:14,258,145...14,270,335
Ensembl chr 9:14,258,145...14,270,303 		JBrowse link
G Ppm1d protein phosphatase, Mg2+/Mn2+ dependent, 1D multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PPM1D mRNA CTD PMID:16635253 NCBI chr10:70,172,603...70,208,607
Ensembl chr10:70,172,603...70,208,607 		JBrowse link
G Ptgds prostaglandin D2 synthase multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PTGDS mRNA CTD PMID:16635253 NCBI chr 3:8,281,899...8,284,833
Ensembl chr 3:8,281,899...8,284,833 		JBrowse link
G Ptgfrn prostaglandin F2 receptor inhibitor multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of PTGFRN mRNA CTD PMID:16635253 NCBI chr 2:188,469,521...188,544,795
Ensembl chr 2:188,469,521...188,544,795 		JBrowse link
G Ptk2b protein tyrosine kinase 2 beta multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of PTK2B mRNA CTD PMID:16635253 NCBI chr15:40,360,722...40,481,235
Ensembl chr15:40,360,723...40,481,282 		JBrowse link
G Ptpn5 protein tyrosine phosphatase, non-receptor type 5 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of PTPN5 mRNA CTD PMID:16635253 NCBI chr 1:97,620,638...97,681,186
Ensembl chr 1:97,620,642...97,679,882 		JBrowse link
G Ptprr protein tyrosine phosphatase, receptor type, R multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PTPRR mRNA CTD PMID:16635253 NCBI chr 7:51,662,595...51,929,605
Ensembl chr 7:51,662,595...51,929,603 		JBrowse link
G Pvalb parvalbumin multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of PVALB mRNA CTD PMID:16635253 NCBI chr 7:109,772,939...109,787,954
Ensembl chr 7:109,772,593...109,784,561 		JBrowse link
G Rbp4 retinol binding protein 4 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of RBP mRNA CTD PMID:16635253 NCBI chr 1:235,893,917...235,901,315
Ensembl chr 1:235,893,917...235,901,399 		JBrowse link
G Rgs12 regulator of G-protein signaling 12 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of RGS12 mRNA CTD PMID:16635253 NCBI chr14:75,715,925...75,824,012
Ensembl chr14:75,715,934...75,794,596 		JBrowse link
G Rgs3 regulator of G-protein signaling 3 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of RGS3 mRNA CTD PMID:16635253 NCBI chr 5:76,022,038...76,161,895
Ensembl chr 5:76,022,001...76,161,894 		JBrowse link
G Rgs4 regulator of G-protein signaling 4 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of RGS4 mRNA CTD PMID:16635253 NCBI chr13:81,936,775...81,943,103
Ensembl chr13:81,936,775...81,943,068 		JBrowse link
G Rpl24 ribosomal protein L24 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of RPL24 mRNA CTD PMID:16635253 NCBI chr11:44,653,937...44,659,346
Ensembl chr11:44,653,937...44,659,370 		JBrowse link
G Rps6ka1 ribosomal protein S6 kinase A1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of RPS6KA1 mRNA CTD PMID:16635253 NCBI chr 5:146,079,018...146,118,272
Ensembl chr 5:146,079,021...146,118,272 		JBrowse link
G Sdc1 syndecan 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of SDC1 mRNA CTD PMID:16635253 NCBI chr 6:31,562,799...31,585,267
Ensembl chr 6:31,562,739...31,585,264 		JBrowse link
G Sh3bp5 SH3-domain binding protein 5 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of SH3BP5 mRNA CTD PMID:16635253 NCBI chr16:6,583,462...6,678,344
Ensembl chr16:6,583,465...6,698,975 		JBrowse link
G Slc1a6 solute carrier family 1 member 6 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of SLC1A6 mRNA CTD PMID:16635253 NCBI chr 7:10,841,836...10,870,424
Ensembl chr 7:10,841,837...10,870,449 		JBrowse link
G Smpd3 sphingomyelin phosphodiesterase 3 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of SMPD3 mRNA CTD PMID:16635253 NCBI chr19:34,162,337...34,245,786
Ensembl chr19:34,162,341...34,245,749 		JBrowse link
G Sparc secreted protein acidic and cysteine rich multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of SPARC mRNA CTD PMID:16635253 NCBI chr10:39,516,394...39,538,252
Ensembl chr10:39,516,406...39,538,396 		JBrowse link
G Spp1 secreted phosphoprotein 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of SPP1 mRNA CTD PMID:16635253 NCBI chr14:5,308,885...5,315,120
Ensembl chr14:5,308,885...5,315,162 		JBrowse link
G Sstr1 somatostatin receptor 1 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in decreased expression of SSTR1 mRNA CTD PMID:16635253 NCBI chr 6:75,832,292...75,836,806
Ensembl chr 6:75,832,530...75,836,802 		JBrowse link
G Sstr3 somatostatin receptor 3 multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of SSTR3 mRNA CTD PMID:16635253 NCBI chr 7:110,092,563...110,109,043
Ensembl chr 7:110,092,575...110,099,769 		JBrowse link
G Tf transferrin multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of TF mRNA CTD PMID:16635253 NCBI chr 8:103,789,780...103,816,487
Ensembl chr 8:103,767,995...103,816,511 		JBrowse link
G Ttr transthyretin multiple interactions EXP [ampullosporin co-treated with Ketamine] results in increased expression of TTR mRNA CTD PMID:16635253 NCBI chr18:11,941,791...11,951,008
Ensembl chr18:11,943,789...11,951,008 		JBrowse link
astressin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Agt angiotensinogen multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr19:52,529,139...52,549,618
Ensembl chr19:52,529,185...52,540,977 		JBrowse link
G Crh corticotropin releasing hormone multiple interactions EXP [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; astressin promotes the reaction [AGT protein results in increased expression of CRH protein] CTD PMID:33872574 NCBI chr 2:102,143,055...102,144,919
Ensembl chr 2:102,143,055...102,144,919 		JBrowse link
G Crhr1 corticotropin releasing hormone receptor 1 multiple interactions ISO astressin binds to and results in decreased activity of CRHR1 protein CTD PMID:16014403 NCBI chr10:89,040,186...89,083,481
Ensembl chr10:89,040,203...89,083,481 		JBrowse link
G Crhr2 corticotropin releasing hormone receptor 2 multiple interactions ISO astressin binds to and results in decreased activity of CRHR2 protein CTD PMID:16014403 NCBI chr 4:84,222,897...84,265,924
Ensembl chr 4:84,224,002...84,265,904 		JBrowse link
G Cyp11a1 cytochrome P450, family 11, subfamily a, polypeptide 1 decreases expression ISO astressin results in decreased expression of CYP11A1 mRNA CTD PMID:16014403 NCBI chr 8:58,422,807...58,434,342
Ensembl chr 8:58,404,669...58,434,338 		JBrowse link
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 decreases expression ISO astressin results in decreased expression of CYP17A1 mRNA CTD PMID:16014403 NCBI chr 1:245,535,462...245,543,148
Ensembl chr 1:245,535,462...245,541,573 		JBrowse link
G Fos Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of FOS protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein] CTD PMID:33872574 NCBI chr 6:105,121,170...105,124,036
Ensembl chr 6:105,121,170...105,124,036 		JBrowse link
G Il1rn interleukin 1 receptor antagonist multiple interactions EXP [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of CRH protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased expression of FOS protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein]; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 3:7,111,567...7,127,451
Ensembl chr 3:7,111,550...7,127,445 		JBrowse link
G Mapk1 mitogen activated protein kinase 1 multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK1 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK1 protein] CTD PMID:33872574 NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616 		JBrowse link
G Mapk3 mitogen activated protein kinase 3 multiple interactions EXP [astressin co-treated with AGT protein] results in increased phosphorylation of MAPK3 protein; [IL1RN protein co-treated with astressin] promotes the reaction [AGT protein results in increased phosphorylation of MAPK3 protein] CTD PMID:33872574 NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863 		JBrowse link
G Star steroidogenic acute regulatory protein decreases expression ISO astressin results in decreased expression of STAR mRNA CTD PMID:16014403 NCBI chr16:66,267,094...66,274,368
Ensembl chr16:66,264,807...66,271,672 		JBrowse link
G Sult2a1 sulfotransferase family 2A member 1 decreases expression ISO astressin results in decreased expression of SULT2A1 mRNA CTD PMID:16014403 NCBI chr 1:75,451,178...75,508,113
Ensembl chr 1:74,911,100...75,508,134 		JBrowse link
G Ucn urocortin multiple interactions
decreases response to substance		 EXP astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Calcium]]; astressin inhibits the reaction [UCN protein inhibits the reaction [Thapsigargin results in increased uptake of Manganese]]
astressin results in decreased susceptibility to UCN protein		 CTD PMID:17885217 PMID:20237592 NCBI chr 6:25,238,120...25,238,950
Ensembl chr 6:25,238,120...25,238,950 		JBrowse link
astressin 2B term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Ccl2 C-C motif chemokine ligand 2 multiple interactions ISO astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CCL2 mRNA] CTD PMID:16920976 NCBI chr10:67,005,424...67,007,222
Ensembl chr10:67,005,424...67,007,226 		JBrowse link
G Cxcl3 C-X-C motif chemokine ligand 3 multiple interactions ISO astressin-2B inhibits the reaction [tcdA protein, Clostridium difficile results in increased expression of CXCL1 mRNA] CTD PMID:16920976 NCBI chr14:17,287,727...17,289,451
Ensembl chr14:17,270,146...17,289,511 		JBrowse link
G Il6 interleukin 6 multiple interactions EXP astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of IL6 protein] CTD PMID:12746300 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Pomc proopiomelanocortin increases secretion EXP astressin-2B results in increased secretion of POMC protein alternative form CTD PMID:12746300 NCBI chr 6:26,939,844...26,945,666
Ensembl chr 6:26,939,837...26,945,664 		JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP astressin-2B promotes the reaction [Lipopolysaccharides results in increased secretion of TNF protein] CTD PMID:12746300 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
G Ucn urocortin decreases activity EXP astressin-2B results in decreased activity of UCN protein CTD PMID:12010772 NCBI chr 6:25,238,120...25,238,950
Ensembl chr 6:25,238,120...25,238,950 		JBrowse link
bacitracin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G A2m alpha-2-macroglobulin increases expression EXP Bacitracin results in increased expression of A2M mRNA CTD PMID:18289764 NCBI chr 4:154,897,770...154,947,787
Ensembl chr 4:154,897,877...154,947,786 		JBrowse link
G Ache acetylcholinesterase multiple interactions ISO Bacitracin binds to and results in decreased metabolism of and results in decreased secretion of ACHE protein CTD PMID:23047022 NCBI chr12:19,406,133...19,413,713
Ensembl chr12:19,407,360...19,413,651 		JBrowse link
G Aldh1a1 aldehyde dehydrogenase 1 family, member A1 increases expression EXP Bacitracin results in increased expression of ALDH1A1 mRNA CTD PMID:18289764 NCBI chr 1:218,000,470...218,152,962
Ensembl chr 1:218,042,127...218,152,961 		JBrowse link
G Anxa5 annexin A5 increases expression EXP Bacitracin results in increased expression of ANXA5 mRNA CTD PMID:18289764 NCBI chr 2:119,314,007...119,344,703
Ensembl chr 2:119,314,007...119,353,369 		JBrowse link
G Bmp1 bone morphogenetic protein 1 increases expression EXP Bacitracin results in increased expression of BMP1 mRNA CTD PMID:18289764 NCBI chr15:45,551,603...45,595,862
Ensembl chr15:45,551,603...45,595,776 		JBrowse link
G Bmp4 bone morphogenetic protein 4 decreases expression EXP Bacitracin results in decreased expression of BMP4 mRNA CTD PMID:18289764 NCBI chr15:19,618,538...19,633,494
Ensembl chr15:19,618,542...19,623,306 		JBrowse link
G Calb1 calbindin 1 decreases expression EXP Bacitracin results in decreased expression of CALB1 mRNA CTD PMID:18289764 NCBI chr 5:29,375,624...29,402,532
Ensembl chr 5:29,375,642...29,402,431 		JBrowse link
G Cat catalase decreases expression EXP Bacitracin results in decreased expression of CAT mRNA CTD PMID:18289764 NCBI chr 3:89,842,393...89,874,577
Ensembl chr 3:89,842,399...89,874,478 		JBrowse link
G Ccn1 cellular communication network factor 1 affects expression EXP Bacitracin affects the expression of CCN1 mRNA CTD PMID:18289764 NCBI chr 2:234,562,410...234,565,370
Ensembl chr 2:234,562,408...234,565,484 		JBrowse link
G Ccnd1 cyclin D1 increases expression EXP Bacitracin results in increased expression of CCND1 mRNA CTD PMID:18289764 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602 		JBrowse link
G Ccng1 cyclin G1 increases expression EXP Bacitracin results in increased expression of CCNG1 mRNA CTD PMID:18289764 NCBI chr10:25,176,231...25,182,604
Ensembl chr10:25,176,234...25,181,641 		JBrowse link
G Cd24 CD24 molecule increases expression EXP Bacitracin results in increased expression of CD24 mRNA CTD PMID:18289764 NCBI chr20:47,074,353...47,079,662
Ensembl chr20:47,073,512...47,079,662 		JBrowse link
G Cd44 CD44 molecule increases expression EXP Bacitracin results in increased expression of CD44 mRNA CTD PMID:18289764 NCBI chr 3:89,155,850...89,244,615
Ensembl chr 3:89,157,058...89,244,620 		JBrowse link
G Clu clusterin increases expression EXP Bacitracin results in increased expression of CLU mRNA CTD PMID:18289764 NCBI chr15:40,161,068...40,200,315
Ensembl chr15:40,174,617...40,200,315 		JBrowse link
G Cp ceruloplasmin increases expression EXP Bacitracin results in increased expression of CP mRNA CTD PMID:18289764 NCBI chr 2:102,439,433...102,498,075
Ensembl chr 2:102,439,624...102,498,075 		JBrowse link
G Ctss cathepsin S increases expression EXP Bacitracin results in increased expression of CTSS mRNA CTD PMID:18289764 NCBI chr 2:183,086,437...183,114,483
Ensembl chr 2:183,086,437...183,114,483 		JBrowse link
G Cyp2d4 cytochrome P450, family 2, subfamily d, polypeptide 4 decreases expression EXP Bacitracin results in decreased expression of CYP2D22 mRNA CTD PMID:18289764 NCBI chr 7:113,882,584...113,891,754
Ensembl chr 7:113,881,618...113,891,759 		JBrowse link
G Egf epidermal growth factor decreases expression EXP Bacitracin results in decreased expression of EGF mRNA CTD PMID:18289764 NCBI chr 2:218,219,408...218,302,359
Ensembl chr 2:218,219,415...218,302,064 		JBrowse link
G Fn1 fibronectin 1 increases expression EXP Bacitracin results in increased expression of FN1 mRNA CTD PMID:18289764 NCBI chr 9:73,196,044...73,264,695
Ensembl chr 9:73,196,044...73,264,678 		JBrowse link
G G6pc1 glucose-6-phosphatase catalytic subunit 1 decreases expression EXP Bacitracin results in decreased expression of G6PC1 mRNA CTD PMID:18289764 NCBI chr10:86,307,400...86,318,766
Ensembl chr10:86,257,668...86,333,804 		JBrowse link
G Gadd45a growth arrest and DNA-damage-inducible, alpha increases expression EXP Bacitracin results in increased expression of GADD45A mRNA CTD PMID:18289764 NCBI chr 4:96,154,789...96,157,091
Ensembl chr 4:96,154,789...96,157,115 		JBrowse link
G Ghr growth hormone receptor affects expression EXP Bacitracin affects the expression of GHR mRNA CTD PMID:18289764 NCBI chr 2:52,541,452...52,804,960
Ensembl chr 2:52,542,594...52,804,735 		JBrowse link
G Glul glutamate-ammonia ligase increases expression EXP Bacitracin results in increased expression of GLUL mRNA CTD PMID:18289764 NCBI chr13:65,969,053...66,035,121
Ensembl chr13:66,025,630...66,035,108 		JBrowse link
G Gstm2 glutathione S-transferase mu 2 increases expression EXP Bacitracin results in increased expression of GSTM2 mRNA CTD PMID:18289764 NCBI chr 2:195,624,015...195,628,774
Ensembl chr 2:195,544,426...195,628,961 		JBrowse link
G Havcr1 hepatitis A virus cellular receptor 1 increases expression EXP Bacitracin results in increased expression of HAVCR1 mRNA CTD PMID:18289764 NCBI chr10:31,118,667...31,151,730
Ensembl chr10:31,119,088...31,151,698 		JBrowse link
G Hmox1 heme oxygenase 1 increases expression EXP Bacitracin results in increased expression of HMOX1 mRNA CTD PMID:18289764 NCBI chr19:13,466,287...13,474,082
Ensembl chr19:13,467,244...13,474,079 		JBrowse link
G Hmox2 heme oxygenase 2 increases expression EXP Bacitracin results in increased expression of HMOX2 mRNA CTD PMID:18289764 NCBI chr10:10,797,076...10,831,178
Ensembl chr10:10,797,055...10,831,148 		JBrowse link
G Igfbp1 insulin-like growth factor binding protein 1 increases expression EXP Bacitracin results in increased expression of IGFBP1 mRNA CTD PMID:18289764 NCBI chr14:82,047,415...82,052,482
Ensembl chr14:82,047,415...82,052,482 		JBrowse link
G Igkc immunoglobulin kappa constant decreases expression
increases expression		 EXP Bacitracin results in decreased expression of IGKC mRNA
Bacitracin results in increased expression of IGKC mRNA		 CTD PMID:18289764
G Jun Jun proto-oncogene, AP-1 transcription factor subunit increases expression EXP Bacitracin results in increased expression of JUN mRNA CTD PMID:18289764 NCBI chr 5:109,894,175...109,897,268
Ensembl chr 5:109,893,145...109,897,656 		JBrowse link
G Klk1b3 kallikrein 1-related peptidase B3 decreases expression EXP Bacitracin results in decreased expression of NGFG mRNA CTD PMID:18289764 NCBI chr 1:94,709,105...94,713,308
Ensembl chr 1:94,709,105...94,713,308 		JBrowse link
G Lcn2 lipocalin 2 increases expression EXP Bacitracin results in increased expression of LCN2 mRNA CTD PMID:18289764 NCBI chr 3:15,680,688...15,684,033
Ensembl chr 3:15,680,687...15,684,095 		JBrowse link
G Mgp matrix Gla protein increases expression EXP Bacitracin results in increased expression of MGP mRNA CTD PMID:18289764 NCBI chr 4:169,766,290...169,769,612
Ensembl chr 4:169,766,279...169,769,667 		JBrowse link
G Mt1 metallothionein 1 increases expression EXP Bacitracin results in increased expression of MT1A mRNA CTD PMID:18289764 NCBI chr19:10,826,032...10,827,048
Ensembl chr19:10,826,032...10,827,049
Ensembl chr17:10,826,032...10,827,049 		JBrowse link
G Nphs2 NPHS2 stomatin family member, podocin decreases expression EXP Bacitracin results in decreased expression of NPHS2 mRNA CTD PMID:18289764 NCBI chr13:68,448,720...68,461,312
Ensembl chr13:68,448,926...68,461,313 		JBrowse link
G Oat ornithine aminotransferase increases expression EXP Bacitracin results in increased expression of OAT mRNA CTD PMID:18289764 NCBI chr 1:187,347,862...187,367,644
Ensembl chr 1:187,347,865...187,367,682 		JBrowse link
G Rgn regucalcin decreases expression EXP Bacitracin results in decreased expression of RGN mRNA CTD PMID:18289764 NCBI chr  X:1,619,030...1,634,456
Ensembl chr  X:1,619,032...1,634,450 		JBrowse link
G Slc22a1 solute carrier family 22 member 1 decreases expression EXP Bacitracin results in decreased expression of SLC22A1 mRNA CTD PMID:18289764 NCBI chr 1:48,076,657...48,103,679
Ensembl chr 1:48,076,666...48,103,678 		JBrowse link
G Slc22a6 solute carrier family 22 member 6 decreases expression EXP Bacitracin results in decreased expression of SLC22A6 mRNA CTD PMID:18289764 NCBI chr 1:205,522,579...205,531,179
Ensembl chr 1:205,522,729...205,531,173 		JBrowse link
G Spp1 secreted phosphoprotein 1 increases expression EXP Bacitracin results in increased expression of SPP1 mRNA CTD PMID:18289764 NCBI chr14:5,308,885...5,315,120
Ensembl chr14:5,308,885...5,315,162 		JBrowse link
G Timp1 TIMP metallopeptidase inhibitor 1 increases expression EXP Bacitracin results in increased expression of TIMP1 mRNA CTD PMID:18289764 NCBI chr  X:1,212,969...1,217,714
Ensembl chr  X:1,212,972...1,217,664 		JBrowse link
G Tmsb10 thymosin, beta 10 increases expression EXP Bacitracin results in increased expression of TMSB10 mRNA CTD PMID:18289764 NCBI chr 4:105,009,959...105,011,095
Ensembl chr 4:105,009,212...105,011,028 		JBrowse link
G Vcam1 vascular cell adhesion molecule 1 increases expression EXP Bacitracin results in increased expression of VCAM1 mRNA CTD PMID:18289764 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958 		JBrowse link
G Vegfa vascular endothelial growth factor A decreases expression EXP Bacitracin results in decreased expression of VEGFA mRNA CTD PMID:18289764 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641 		JBrowse link
G Vim vimentin increases expression EXP Bacitracin results in increased expression of VIM mRNA CTD PMID:18289764 NCBI chr17:76,668,701...76,677,186
Ensembl chr17:76,668,647...76,677,187 		JBrowse link
beta-endorphin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Agt angiotensinogen increases abundance
multiple interactions		 EXP AGT protein results in increased abundance of beta-Endorphin
IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin]		 CTD PMID:33872574 NCBI chr19:52,529,139...52,549,618
Ensembl chr19:52,529,185...52,540,977 		JBrowse link
G Crh corticotropin releasing hormone decreases secretion
increases secretion
multiple interactions		 EXP beta-Endorphin results in decreased secretion of CRH protein
CRF protein results in increased secretion of beta-Endorphin
adinazolam inhibits the reaction [CRF protein results in increased secretion of beta-Endorphin]; beta-Endorphin inhibits the reaction [Nitroprusside results in increased secretion of CRH protein]; Naltrexone inhibits the reaction [beta-Endorphin results in decreased secretion of CRH protein]		 CTD PMID:1480515 PMID:3031743 NCBI chr 2:102,143,055...102,144,919
Ensembl chr 2:102,143,055...102,144,919 		JBrowse link
G Il1rn interleukin 1 receptor antagonist multiple interactions EXP IL1RN protein inhibits the reaction [AGT protein results in increased abundance of beta-Endorphin] CTD PMID:33872574 NCBI chr 3:7,111,567...7,127,451
Ensembl chr 3:7,111,550...7,127,445 		JBrowse link
G Il2 interleukin 2 decreases expression ISO beta-Endorphin results in decreased expression of IL2 mRNA CTD PMID:23965172 NCBI chr 2:120,004,862...120,009,566
Ensembl chr 2:120,004,862...120,009,566 		JBrowse link
G Il4 interleukin 4 increases expression ISO beta-Endorphin results in increased expression of IL4 mRNA CTD PMID:23965172 NCBI chr10:37,771,203...37,776,750
Ensembl chr10:37,771,203...37,776,750 		JBrowse link
G Mapk1 mitogen activated protein kinase 1 increases phosphorylation ISO beta-Endorphin results in increased phosphorylation of MAPK1 protein CTD PMID:23965172 NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616 		JBrowse link
G Mapk3 mitogen activated protein kinase 3 increases phosphorylation ISO beta-Endorphin results in increased phosphorylation of MAPK3 protein CTD PMID:23965172 NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863 		JBrowse link
G Nfkbia NFKB inhibitor alpha increases expression ISO beta-Endorphin results in increased expression of NFKBIA protein CTD PMID:22258905 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941 		JBrowse link
G Pld2 phospholipase D2 increases activity ISO beta-Endorphin results in increased activity of PLD2 protein CTD PMID:23965172 NCBI chr10:55,256,326...55,274,192
Ensembl chr10:55,256,359...55,272,808 		JBrowse link
G Usp15 ubiquitin specific peptidase 15 increases expression ISO beta-Endorphin results in increased expression of USP15 mRNA CTD PMID:24068670 NCBI chr 7:58,756,714...58,848,778
Ensembl chr 7:58,756,872...58,848,721 		JBrowse link
bivalirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Crp C-reactive protein decreases expression ISO bivalirudin results in decreased expression of CRP protein CTD PMID:16118546 NCBI chr13:85,135,384...85,175,178
Ensembl chr13:85,124,977...85,175,178 		JBrowse link
G F2 coagulation factor II, thrombin multiple interactions
decreases activity
increases cleavage		 ISO bivalirudin binds to and results in decreased activity of F2 protein; bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein]
bivalirudin results in decreased activity of F2 protein
F2 protein results in increased cleavage of bivalirudin		 CTD PMID:1290488 PMID:8456428 PMID:15080313 PMID:15155122 PMID:16084352 More... NCBI chr 3:77,596,196...77,609,486
Ensembl chr 3:77,596,198...77,609,486 		JBrowse link
G F2r coagulation factor II (thrombin) receptor decreases activity ISO bivalirudin results in decreased activity of F2R protein CTD PMID:19124943 NCBI chr 2:26,869,343...26,885,856
Ensembl chr 2:26,868,404...26,885,870 		JBrowse link
G F2rl3 F2R like thrombin or trypsin receptor 3 decreases activity ISO bivalirudin results in decreased activity of F2RL3 protein CTD PMID:19124943 NCBI chr16:17,117,441...17,119,434
Ensembl chr16:17,117,441...17,119,472 		JBrowse link
G Mpo myeloperoxidase decreases expression ISO bivalirudin results in decreased expression of MPO protein CTD PMID:18701766 NCBI chr10:72,594,883...72,608,862
Ensembl chr10:72,594,661...72,604,819 		JBrowse link
G P2ry12 purinergic receptor P2Y12 affects response to substance ISO P2RY12 affects the susceptibility to bivalirudin CTD PMID:14597584 NCBI chr 2:143,481,468...143,523,340
Ensembl chr 2:143,481,430...143,523,361 		JBrowse link
G Pdgfb platelet derived growth factor subunit B affects expression EXP bivalirudin affects the expression of PDGFB protein CTD PMID:10754393 PMID:11316950 NCBI chr 7:111,539,444...111,557,984
Ensembl chr 7:111,540,345...111,557,984 		JBrowse link
G Selp selectin P multiple interactions ISO bivalirudin inhibits the reaction [F2 protein results in increased expression of SELP protein] CTD PMID:16845256 NCBI chr13:76,476,229...76,511,846
Ensembl chr13:76,476,295...76,511,845 		JBrowse link
calcitonin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Hcrt hypocretin neuropeptide precursor decreases expression EXP salmon calcitonin results in decreased expression of HCRT mRNA CTD PMID:12686383 NCBI chr10:85,689,979...85,691,214
Ensembl chr10:85,689,465...85,691,210 		JBrowse link
G Pmch pro-melanin-concentrating hormone decreases expression EXP salmon calcitonin results in decreased expression of PMCH mRNA CTD PMID:12686383 NCBI chr 7:22,511,934...22,513,250
Ensembl chr 7:22,511,934...22,513,250 		JBrowse link
corticotropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Ada adenosine deaminase increases activity ISO Adrenocorticotropic Hormone results in increased activity of ADA protein CTD PMID:8868375 NCBI chr 3:152,398,745...152,422,854
Ensembl chr 3:152,398,747...152,447,088 		JBrowse link
G Calca calcitonin-related polypeptide alpha increases abundance EXP CALCA protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:12639925 NCBI chr 1:168,878,212...168,883,176
Ensembl chr 1:168,878,214...168,883,105 		JBrowse link
G Cnp 2',3'-cyclic nucleotide 3' phosphodiesterase decreases activity EXP Adrenocorticotropic Hormone results in decreased activity of CNP protein CTD PMID:3030154 NCBI chr10:85,511,164...85,517,723
Ensembl chr10:85,511,160...85,517,720 		JBrowse link
G Crh corticotropin releasing hormone multiple interactions
increases secretion		 EXP Astemizole inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]; E 4031 inhibits the reaction [Corticosterone inhibits the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone]]; Tetraethylammonium promotes the reaction [CRH protein results in increased secretion of Adrenocorticotropic Hormone] CTD PMID:18835572 NCBI chr 2:102,143,055...102,144,919
Ensembl chr 2:102,143,055...102,144,919 		JBrowse link
G Cyp17a1 cytochrome P450, family 17, subfamily a, polypeptide 1 affects abundance ISO CYP17A1 protein affects the abundance of Adrenocorticotropic Hormone CTD PMID:18645707 NCBI chr 1:245,535,462...245,543,148
Ensembl chr 1:245,535,462...245,541,573 		JBrowse link
G Gh1 growth hormone 1 multiple interactions ISO Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr10:91,228,102...91,230,079
Ensembl chr10:91,228,103...91,230,078 		JBrowse link
G Htr2a 5-hydroxytryptamine receptor 2A multiple interactions
affects expression		 EXP Bupropion inhibits the reaction [Adrenocorticotropic Hormone affects the expression of HTR2A mRNA] CTD PMID:18239281 NCBI chr15:49,950,035...50,022,188
Ensembl chr15:49,950,804...50,020,928 		JBrowse link
G Ins2 insulin 2 multiple interactions ISO Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 NCBI chr 1:197,843,277...197,992,522
Ensembl chr 1:197,843,281...197,864,775 		JBrowse link
G Nr3c1 nuclear receptor subfamily 3, group C, member 1 affects abundance ISO NR3C1 gene polymorphism affects the abundance of Adrenocorticotropic Hormone CTD PMID:17716631 NCBI chr18:31,271,681...31,393,320
Ensembl chr18:31,271,681...31,393,375 		JBrowse link
G Ppp1r1b protein phosphatase 1, regulatory (inhibitor) subunit 1B multiple interactions ISO Cocaine promotes the reaction [PPP1R1B protein results in increased abundance of Adrenocorticotropic Hormone] CTD PMID:10516482 NCBI chr10:83,347,731...83,356,775
Ensembl chr10:83,347,731...83,356,775 		JBrowse link
G Ucn2 urocortin 2 increases abundance ISO UCN2 protein results in increased abundance of Adrenocorticotropic Hormone CTD PMID:16330704 NCBI chr 8:109,637,624...109,639,173
Ensembl chr 8:109,638,285...109,639,172 		JBrowse link
corticotropin-releasing hormone term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Crhr1 corticotropin releasing hormone receptor 1 increases expression
decreases activity
multiple interactions		 EXP Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA
Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein
Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in decreased activity of CRHR1 protein]; Pentobarbital inhibits the reaction [Corticotropin-Releasing Hormone results in increased expression of CRHR1 mRNA]		 CTD PMID:12093084 NCBI chr10:89,040,186...89,083,481
Ensembl chr10:89,040,203...89,083,481 		JBrowse link
cosyntropin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Hsd11b2 hydroxysteroid 11-beta dehydrogenase 2 decreases expression ISO Cosyntropin results in decreased expression of HSD11B2 protein CTD PMID:11082157 NCBI chr19:33,397,656...33,402,899
Ensembl chr19:33,397,656...33,402,899 		JBrowse link
enfuvirtide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Cyp1a2 cytochrome P450, family 1, subfamily a, polypeptide 2 affects activity ISO enfuvirtide affects the activity of CYP1A2 protein CTD PMID:15656696 NCBI chr 8:58,075,367...58,082,255
Ensembl chr 8:58,075,367...58,082,312 		JBrowse link
G Cyp2c6 cytochrome P450, family 2, subfamily C, polypeptide 6 affects activity ISO enfuvirtide affects the activity of CYP2C19 protein CTD PMID:15656696 NCBI chr 1:237,938,521...237,976,238
Ensembl chr 1:237,693,094...238,057,596 		JBrowse link
G Cyp2e1 cytochrome P450, family 2, subfamily e, polypeptide 1 affects activity ISO enfuvirtide affects the activity of CYP2E1 protein CTD PMID:15656696 NCBI chr 1:195,840,330...195,850,728
Ensembl chr 1:195,840,058...195,864,023 		JBrowse link
ganirelix term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Lhb luteinizing hormone subunit beta decreases secretion
decreases expression		 ISO ganirelix results in decreased secretion of LHB protein
ganirelix results in decreased expression of LHB protein		 CTD PMID:17579202 PMID:21273126 NCBI chr 1:95,898,269...95,901,973
Ensembl chr 1:95,900,984...95,901,972
Ensembl chr 1:95,900,984...95,901,972 		JBrowse link
gastrin-17 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Birc2 baculoviral IAP repeat-containing 2 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2 CTD PMID:17704804 NCBI chr 8:4,968,856...4,989,325
Ensembl chr 8:4,968,842...4,988,732 		JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3 CTD PMID:17704804 NCBI chr 8:5,000,844...5,028,470
Ensembl chr 8:5,000,845...5,015,802 		JBrowse link
G Cckbr cholecystokinin B receptor multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC2; [gastrin 17 co-treated with CCKBR protein] results in decreased expression of BIRC3; [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr 1:159,771,733...159,781,738
Ensembl chr 1:159,771,733...159,814,881 		JBrowse link
G Ier3 immediate early response 3 multiple interactions ISO [gastrin 17 co-treated with CCKBR protein] results in increased expression of IER3 mRNA CTD PMID:17704804 NCBI chr20:2,928,378...2,929,582
Ensembl chr20:2,928,378...2,929,583 		JBrowse link
G Nfkb1 nuclear factor kappa B subunit 1 decreases activity ISO gastrin 17 results in decreased activity of NFKB1 protein CTD PMID:15623601 NCBI chr 2:224,016,214...224,132,135
Ensembl chr 2:224,016,214...224,110,404 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit decreases activity ISO gastrin 17 results in decreased activity of RELA protein CTD PMID:15623601 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Sele selectin E decreases expression ISO gastrin 17 results in decreased expression of SELE protein CTD PMID:15623601 NCBI chr13:76,402,841...76,412,741
Ensembl chr13:76,403,304...76,412,741 		JBrowse link
ghrelin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Cnr1 cannabinoid receptor 1 multiple interactions EXP Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 NCBI chr 5:48,408,543...48,436,099
Ensembl chr 5:48,408,574...48,435,099 		JBrowse link
G Glp1r glucagon-like peptide 1 receptor multiple interactions EXP Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 NCBI chr20:8,972,004...9,010,241
Ensembl chr20:8,972,004...9,010,241 		JBrowse link
G Il1b interleukin 1 beta multiple interactions ISO ghrelin inhibits the reaction [High fat diet increases expression of IL1b mRNA in heart] RGD PMID:32084395 RGD:242905211 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415 		JBrowse link
G Il6 interleukin 6 multiple interactions ISO ghrelin inhibits the reaction [High fat diet increases expression of Il6 mRNA in heart] RGD PMID:32084395 RGD:242905211 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Mir33 microRNA 33 multiple interactions EXP Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in increased expression of MIR33A mRNA] CTD PMID:31468622 NCBI chr 7:113,713,855...113,713,923
Ensembl chr 7:113,713,855...113,713,923 		JBrowse link
G Tgfb1 transforming growth factor, beta 1 multiple interactions ISO ghrelin inhibits the reaction [High fat diet increases expression of Tgfb1 mRNA in heart] RGD PMID:32084395 RGD:242905211 NCBI chr 1:81,196,532...81,212,848
Ensembl chr 1:81,196,532...81,212,847 		JBrowse link
G Tnf tumor necrosis factor multiple interactions ISO ghrelin inhibits the reaction [high fat diet increases expression of TNF mRNA in heart] RGD PMID:32084395 RGD:242905211 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
high-density lipoprotein term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Itgam integrin subunit alpha M multiple interactions ISO High-density lipoprotein inhibits the reaction [cholesterol increases expression of ITGAM protein on monocytes and granulocytes]
High-density lipoprotein inhibits the reaction [PMA increases expression of ITGAM protein on monocytes]		 RGD PMID:26026058 PMID:18617650 RGD:329853768, RGD:329901662 NCBI chr 1:182,659,047...182,709,501
Ensembl chr 1:182,659,000...182,709,503 		JBrowse link
insulin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Akt1 AKT serine/threonine kinase 1 multiple interactions
increases activity		 ISO
EXP		 [2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine co-treated with Insulin] results in decreased phosphorylation of AKT1 protein; [2-amino-3,4-dimethylimidazo(4,5-f)quinoline co-treated with Insulin] results in decreased phosphorylation of AKT1 protein; [2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline co-treated with Insulin] results in decreased phosphorylation of AKT1 protein
Insulin increases activity of Akt1 protein in adipocytes		 CTD
RGD		 PMID:37005939 PMID:9065430 RGD:407420264 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921 		JBrowse link
G Akt2 AKT serine/threonine kinase 2 multiple interactions ISO [2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine co-treated with Insulin] results in decreased phosphorylation of AKT2 protein; [2-amino-3,4-dimethylimidazo(4,5-f)quinoline co-treated with Insulin] results in decreased phosphorylation of AKT2 protein; [2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline co-treated with Insulin] results in decreased phosphorylation of AKT2 protein CTD PMID:37005939 NCBI chr 1:82,877,228...82,933,828
Ensembl chr 1:82,883,547...82,933,817 		JBrowse link
G Akt3 AKT serine/threonine kinase 3 multiple interactions ISO [2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine co-treated with Insulin] results in decreased phosphorylation of AKT3 protein; [2-amino-3,4-dimethylimidazo(4,5-f)quinoline co-treated with Insulin] results in decreased phosphorylation of AKT3 protein; [2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline co-treated with Insulin] results in decreased phosphorylation of AKT3 protein CTD PMID:37005939 NCBI chr13:88,943,708...89,225,831
Ensembl chr13:88,946,091...89,225,708 		JBrowse link
G Casp1 caspase 1 multiple interactions EXP Insulin promotes the reaction [Ozone inhibits the reaction [Streptozocin results in increased expression of CASP1 mRNA]] CTD PMID:26614261 NCBI chr 8:2,587,812...2,597,403
Ensembl chr 8:2,587,831...2,597,383 		JBrowse link
G Casp3 caspase 3 multiple interactions EXP Insulin promotes the reaction [Ozone inhibits the reaction [Streptozocin results in increased expression of CASP3 mRNA]] CTD PMID:26614261 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648 		JBrowse link
G Casp9 caspase 9 multiple interactions EXP Insulin promotes the reaction [Ozone inhibits the reaction [Streptozocin results in increased expression of CASP9 mRNA]] CTD PMID:26614261 NCBI chr 5:154,108,872...154,126,628
Ensembl chr 5:154,109,046...154,126,626 		JBrowse link
G Cebpa CCAAT/enhancer binding protein alpha multiple interactions ISO [Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of CEBPA mRNA; cordycepin inhibits the reaction [[Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of CEBPA mRNA] CTD PMID:34575692 NCBI chr 1:87,759,631...87,762,303
Ensembl chr 1:87,759,433...87,762,412 		JBrowse link
G Fabp4 fatty acid binding protein 4 multiple interactions ISO [Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of FABP4 mRNA; cordycepin inhibits the reaction [[Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of FABP4 mRNA] CTD PMID:34575692 NCBI chr 2:91,580,879...91,585,567
Ensembl chr 2:91,580,885...91,585,578 		JBrowse link
G Hif1a hypoxia inducible factor 1 subunit alpha multiple interactions EXP Insulin promotes the reaction [Ozone inhibits the reaction [Streptozocin results in increased expression of HIF1A mRNA]] CTD PMID:26614261 NCBI chr 6:92,624,059...92,669,262
Ensembl chr 6:92,624,390...92,669,261 		JBrowse link
G Insr insulin receptor decreases expression EXP insulin decreases expression of hepatic mRNA in streptozocin treated rats RGD PMID:1280238 RGD:15036814 NCBI chr12:1,193,193...1,330,976
Ensembl chr12:1,197,100...1,330,883 		JBrowse link
G Kcnn4 potassium calcium-activated channel subfamily N member 4 increases expression
multiple interactions		 EXP insulin increases expression of Kcnn4 mRNA and protein in vascular smooth muscle cells
2-(2-amino-3-methoxyphenyl)chromen-4-one inhibits the reaction [insulin increases expression of Kcnn4 mRNA and protein in vascular smooth muscle cells]		 RGD PMID:21463632 PMID:21463632 RGD:401794561, RGD:401794561 NCBI chr 1:79,956,380...79,974,354
Ensembl chr 1:79,959,322...79,974,340 		JBrowse link
G Lpl lipoprotein lipase multiple interactions ISO [Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of LPL mRNA; cordycepin inhibits the reaction [[Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of LPL mRNA] CTD PMID:34575692 NCBI chr16:20,830,055...20,853,855
Ensembl chr16:20,829,465...20,855,249 		JBrowse link
G Mapk8 mitogen-activated protein kinase 8 multiple interactions EXP [[Paraquat results in increased phosphorylation of MAPK8 protein] which results in decreased abundance of Insulin] which results in increased abundance of Glucose CTD PMID:36394833 NCBI chr16:8,638,897...8,721,960
Ensembl chr16:8,638,924...8,721,981 		JBrowse link
G Mir210 microRNA 210 increases expression
multiple interactions		 EXP Insulin increases expression of Mir210 miRNA in myocardial cell
LY294002 inhibits the reaction [Insulin increases expression of Mir210 miRNA in myocardial cell]		 RGD PMID:25968948 PMID:25968948 RGD:11086706, RGD:11086706 NCBI chr 1:196,326,343...196,326,452
Ensembl chr 1:196,326,337...196,326,454 		JBrowse link
G Pparg peroxisome proliferator-activated receptor gamma multiple interactions ISO [Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of PPARG mRNA; cordycepin inhibits the reaction [[Dexamethasone co-treated with Insulin co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of PPARG mRNA] CTD PMID:34575692 NCBI chr 4:148,423,102...148,548,471
Ensembl chr 4:148,423,194...148,548,468 		JBrowse link
G Srebf1 sterol regulatory element binding transcription factor 1 increases expression
multiple interactions		 EXP
ISO		 insulin increases expression of Srebf1 mRNA in hepatoma cells
cilostazol inhibits the reaction [insulin increases expression of Srebf1 mRNA in liver cancer cells]
cilostazol inhibits the reaction [insulin increases expression of Srebf1 mRNA in primary hepatocytes]
cilostazol inhibits the reaction [insulin increases expression of Srebf1 mRNA in hepatoma cells] 		RGD PMID:24458133 PMID:24458133 PMID:24458133 PMID:24458133 PMID:24458133 More... RGD:401842379, RGD:401842379, RGD:401842379, RGD:401842379, RGD:401842379, RGD:401842379 NCBI chr10:45,007,637...45,029,650
Ensembl chr10:45,007,637...45,029,650 		JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP Insulin promotes the reaction [Ozone inhibits the reaction [Streptozocin results in increased expression of TNF mRNA]] CTD PMID:26614261 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
insulin (human) term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Tnf tumor necrosis factor increases secretion EXP Novorapid inhibits the reaction [Lipopolysaccharide increases secretion of Tnf protein in serum] RGD PMID:18078960 RGD:15023464 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
lepirudin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G F2 coagulation factor II, thrombin multiple interactions ISO lepirudin binds to and results in decreased activity of F2 protein CTD PMID:15080313 PMID:18449412 NCBI chr 3:77,596,196...77,609,486
Ensembl chr 3:77,596,198...77,609,486 		JBrowse link
liraglutide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Acaca acetyl-CoA carboxylase alpha multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr10:69,014,261...69,276,453
Ensembl chr10:69,014,170...69,276,457 		JBrowse link
G Adam33 ADAM metallopeptidase domain 33 decreases methylation
increases expression		 ISO Liraglutide results in decreased methylation of ADAM33 promoter
Liraglutide results in increased expression of ADAM33 mRNA; Liraglutide results in increased expression of ADAM33 protein		 CTD PMID:34534549 NCBI chr 3:118,262,395...118,283,456
Ensembl chr 3:118,271,029...118,283,461 		JBrowse link
G Adipoq adiponectin, C1Q and collagen domain containing multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein] CTD PMID:32898504 NCBI chr11:77,721,912...77,735,644
Ensembl chr11:77,721,912...77,735,564 		JBrowse link
G Akt1 AKT serine/threonine kinase 1 multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of AKT1 protein]] CTD PMID:31173752 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921 		JBrowse link
G Bax BCL2 associated X, apoptosis regulator multiple interactions ISO
EXP		 Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased expression of BAX protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of BAX protein]		 CTD PMID:31173752 PMID:31362085 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368 		JBrowse link
G Bcl2 BCL2, apoptosis regulator multiple interactions ISO
EXP		 Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased expression of BCL2 protein]]
Liraglutide inhibits the reaction [Methotrexate results in decreased expression of BCL2 protein]		 CTD PMID:31173752 PMID:31362085 NCBI chr13:22,689,783...22,853,920
Ensembl chr13:22,684,989...22,853,743
Ensembl chr13:22,684,989...22,853,743 		JBrowse link
G Casp3 caspase 3 multiple interactions ISO
EXP		 Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased cleavage of CASP3 protein]]
Liraglutide inhibits the reaction [Methotrexate results in increased expression of and results in increased activity of CASP3 protein]		 CTD PMID:31173752 PMID:31362085 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648 		JBrowse link
G Cdh1 cadherin 1 increases expression
decreases methylation		 ISO Liraglutide results in increased expression of CDH1 mRNA; Liraglutide results in increased expression of CDH1 protein
Liraglutide results in decreased methylation of CDH1 promoter		 CTD PMID:34534549 NCBI chr19:34,492,371...34,561,775
Ensembl chr19:34,492,371...34,561,775 		JBrowse link
G Cpt1a carnitine palmitoyltransferase 1A multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein] CTD PMID:32898504 NCBI chr 1:200,564,634...200,627,059
Ensembl chr 1:200,565,613...200,627,055 		JBrowse link
G Creb1 cAMP responsive element binding protein 1 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in decreased phosphorylation of CREB1 protein] CTD PMID:31362085 NCBI chr 9:65,903,511...65,972,562
Ensembl chr 9:65,903,547...65,970,816 		JBrowse link
G Cyba cytochrome b-245 alpha chain multiple interactions ISO Liraglutide inhibits the reaction [Pyruvaldehyde results in increased expression of CYBA mRNA] CTD PMID:35985417 NCBI chr19:50,487,598...50,495,669
Ensembl chr19:50,487,597...50,495,721 		JBrowse link
G Cybb cytochrome b-245 beta chain multiple interactions ISO Liraglutide inhibits the reaction [Pyruvaldehyde results in increased expression of CYBB mRNA] CTD PMID:35985417 NCBI chr  X:13,358,101...13,392,570
Ensembl chr  X:13,359,430...13,392,586 		JBrowse link
G Dgat1 diacylglycerol O-acyltransferase 1 multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein] CTD PMID:32898504 NCBI chr 7:108,223,860...108,235,413
Ensembl chr 7:108,218,524...108,234,299 		JBrowse link
G Esr1 estrogen receptor 1 increases expression ISO Liraglutide results in increased expression of ESR1 mRNA; Liraglutide results in increased expression of ESR1 protein CTD PMID:34534549 NCBI chr 1:41,106,335...41,499,104
Ensembl chr 1:41,210,475...41,495,002 		JBrowse link
G Glp1r glucagon-like peptide 1 receptor multiple interactions
increases activity
increases expression		 EXP
ISO		 Liraglutide inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA]
Liraglutide results in increased activity of GLP1R protein
Liraglutide binds to and results in increased activity of GLP1R protein
Liraglutide results in increased expression of GLP1R mRNA		 CTD PMID:23354098 PMID:23471186 PMID:35985417 NCBI chr20:8,972,004...9,010,241
Ensembl chr20:8,972,004...9,010,241 		JBrowse link
G Gpt glutamic--pyruvic transaminase multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of GPT protein] CTD PMID:31362085 NCBI chr 7:108,416,646...108,419,495
Ensembl chr 7:108,416,642...108,419,494 		JBrowse link
G Gsk3b glycogen synthase kinase 3 beta multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in decreased phosphorylation of GSK3B protein]] CTD PMID:31173752 NCBI chr11:62,498,997...62,648,665
Ensembl chr11:62,504,316...62,648,646 		JBrowse link
G Hmox1 heme oxygenase 1 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of HMOX1 protein] CTD PMID:31362085 NCBI chr19:13,466,287...13,474,082
Ensembl chr19:13,467,244...13,474,079 		JBrowse link
G Il1b interleukin 1 beta multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of CPT1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of DGAT1 protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein]; Liraglutide inhibits the reaction [IL1B protein results in decreased secretion of ADIPOQ protein]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein]; Liraglutide inhibits the reaction [IL1B protein results in increased phosphorylation of ACACA protein] CTD PMID:32898504 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415 		JBrowse link
G Il6 interleukin 6 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of IL6 protein] CTD PMID:31362085 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Mapt microtubule-associated protein tau multiple interactions ISO Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]; Wortmannin inhibits the reaction [Liraglutide inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of MAPT protein]] CTD PMID:31173752 NCBI chr10:89,138,644...89,236,137
Ensembl chr10:89,138,627...89,236,129 		JBrowse link
G Nfe2l2 NFE2 like bZIP transcription factor 2 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in decreased expression of NFE2L2 protein] CTD PMID:31362085 NCBI chr 3:60,594,239...60,621,712
Ensembl chr 3:60,594,242...60,621,737 		JBrowse link
G Nox4 NADPH oxidase 4 multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 mRNA]; Liraglutide inhibits the reaction [IL1B protein results in increased expression of NOX4 protein] CTD PMID:32898504 NCBI chr 1:140,900,886...141,078,844
Ensembl chr 1:140,901,097...141,077,406 		JBrowse link
G Ppargc1a PPARG coactivator 1 alpha multiple interactions ISO Liraglutide inhibits the reaction [IL1B protein results in decreased expression of PPARGC1A protein] CTD PMID:32898504 NCBI chr14:58,860,752...59,516,525
Ensembl chr14:58,861,144...59,512,656 		JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of PTGS2 protein] CTD PMID:31362085 NCBI chr13:62,163,936...62,172,193
Ensembl chr13:62,163,932...62,172,188 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of RELA protein] CTD PMID:31362085 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Sftpa1 surfactant protein A1 increases expression
multiple interactions		 EXP Liraglutide results in increased expression of SFTPA1 mRNA
Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 mRNA]; Liraglutide inhibits the reaction [nitrofen results in decreased expression of SFTPA1 protein]		 CTD PMID:23354098 NCBI chr16:17,008,180...17,011,686
Ensembl chr16:17,008,180...17,011,685 		JBrowse link
G Sftpb surfactant protein B increases expression EXP Liraglutide results in increased expression of SFTPB mRNA CTD PMID:23354098 NCBI chr 4:104,359,303...104,368,439
Ensembl chr 4:104,359,396...104,368,436 		JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP Liraglutide inhibits the reaction [Methotrexate results in increased expression of TNF protein] CTD PMID:31362085 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
G Tsc1 TSC complex subunit 1 multiple interactions EXP Liraglutide reverses the reaction [palmitate fatty acid decreases expression of tsc1 protein in hepatocytes] RGD PMID:31787541 RGD:25823196 NCBI chr 3:11,969,547...12,018,591
Ensembl chr 3:11,979,729...12,015,674 		JBrowse link
G Xdh xanthine dehydrogenase multiple interactions ISO Liraglutide inhibits the reaction [Pyruvaldehyde results in increased expression of XDH mRNA] CTD PMID:35985417 NCBI chr 6:21,530,463...21,592,172
Ensembl chr 6:21,530,113...21,592,268 		JBrowse link
lixisenatide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Il18 interleukin 18 multiple interactions ISO lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of IL18 mRNA]; lixisenatide inhibits the reaction [Lipopolysaccharides results in increased secretion of IL18 protein] CTD PMID:38229325 NCBI chr 8:50,904,630...50,932,887
Ensembl chr 8:50,906,960...50,932,887 		JBrowse link
G Il6 interleukin 6 multiple interactions ISO lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; lixisenatide inhibits the reaction [Lipopolysaccharides results in increased secretion of IL6 protein] CTD PMID:38229325 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Muc5ac mucin 5AC, oligomeric mucus/gel-forming multiple interactions ISO lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of MUC5AC mRNA]; lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of MUC5AC protein]; NFE2L2 protein affects the reaction [lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of MUC5AC mRNA]]; NFE2L2 protein affects the reaction [lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of MUC5AC protein]] CTD PMID:38229325 NCBI chr 1:196,864,336...196,896,475
Ensembl chr 1:196,864,336...196,896,475 		JBrowse link
G Nfe2l2 NFE2 like bZIP transcription factor 2 multiple interactions ISO NFE2L2 protein affects the reaction [lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of MUC5AC mRNA]]; NFE2L2 protein affects the reaction [lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of MUC5AC protein]] CTD PMID:38229325 NCBI chr 3:60,594,239...60,621,712
Ensembl chr 3:60,594,242...60,621,737 		JBrowse link
G Nfkbia NFKB inhibitor alpha multiple interactions ISO lixisenatide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein] CTD PMID:38229325 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions ISO lixisenatide inhibits the reaction [Lipopolysaccharides results in decreased expression of RELA mRNA]; lixisenatide inhibits the reaction [Lipopolysaccharides results in decreased expression of RELA protein]; lixisenatide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of RELA protein] CTD PMID:38229325 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Tnf tumor necrosis factor multiple interactions ISO lixisenatide inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; lixisenatide inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein] CTD PMID:38229325 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
low-density lipoprotein term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Itgam integrin subunit alpha M increases expression ISO Low-density lipoprotein increases expression of ITGAM protein on monocytes RGD PMID:22901456 RGD:329853769 NCBI chr 1:182,659,047...182,709,501
Ensembl chr 1:182,659,000...182,709,503 		JBrowse link
mastoparan term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Abca1 ATP binding cassette subfamily A member 1 multiple interactions
increases phosphorylation		 ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]]
mastoparan results in increased phosphorylation of ABCA1 protein		 CTD PMID:16118212 NCBI chr 5:67,678,267...67,801,162
Ensembl chr 5:67,681,297...67,801,170 		JBrowse link
G Apoa1 apolipoprotein A1 multiple interactions ISO mastoparan inhibits the reaction [APOA1 protein affects the reaction [ABCA1 protein results in increased export of Cholesterol]] CTD PMID:16118212 NCBI chr 8:46,527,251...46,529,035
Ensembl chr 8:46,527,144...46,529,035 		JBrowse link
G Calm1 calmodulin 1 affects binding EXP mastoparan binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227 		JBrowse link
G Il6 interleukin 6 multiple interactions ISO mastoparan inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein] CTD PMID:21255617 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP mastoparan results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945 		JBrowse link
melittin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Actb actin, beta increases expression ISO Melitten results in increased expression of ACTB protein CTD PMID:34375656 NCBI chr12:11,663,112...11,666,697
Ensembl chr12:11,663,109...11,672,877 		JBrowse link
G Adam10 ADAM metallopeptidase domain 10 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM10 protein CTD PMID:22613720 NCBI chr 8:71,346,008...71,477,889
Ensembl chr 8:71,345,837...71,477,889 		JBrowse link
G Adam17 ADAM metallopeptidase domain 17 multiple interactions ISO Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 NCBI chr 6:40,872,936...40,920,700
Ensembl chr 6:40,872,856...40,920,639 		JBrowse link
G Aim2 absent in melanoma 2 multiple interactions ISO AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]; AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein] CTD PMID:22973906 NCBI chr13:85,865,206...85,906,996
Ensembl chr13:85,866,284...85,906,975 		JBrowse link
G Akt1 AKT serine/threonine kinase 1 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein] CTD PMID:22926441 NCBI chr 6:131,713,716...131,735,319
Ensembl chr 6:131,713,720...131,733,921 		JBrowse link
G Alox5 arachidonate 5-lipoxygenase increases activity ISO Melitten results in increased activity of ALOX5 protein CTD PMID:18475477 NCBI chr 4:149,531,329...149,578,696
Ensembl chr 4:149,531,515...149,578,743 		JBrowse link
G Apaf1 apoptotic peptidase activating factor 1 multiple interactions EXP
ISO		 Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]		 CTD PMID:21354845 PMID:21871910 NCBI chr 7:25,494,143...25,579,540
Ensembl chr 7:25,494,609...25,579,540 		JBrowse link
G Atp5po ATP synthase peripheral stalk subunit OSCP decreases expression ISO Melitten results in decreased expression of ATP5PO mRNA CTD PMID:37678661 NCBI chr11:31,165,218...31,171,530
Ensembl chr11:31,165,217...31,171,592 		JBrowse link
G Bak1 BCL2-antagonist/killer 1 increases expression ISO Melitten results in increased expression of BAK1 protein CTD PMID:34375656 NCBI chr20:5,100,480...5,109,669
Ensembl chr20:5,100,480...5,109,264 		JBrowse link
G Bax BCL2 associated X, apoptosis regulator multiple interactions
increases expression		 ISO Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]
Melitten results in increased expression of BAX protein
Melitten analog results in increased expression of BAX mRNA; Melitten analog results in increased expression of BAX protein; Melitten results in increased expression of BAX protein		 CTD PMID:21871910 PMID:22027265 PMID:29387245 PMID:34375656 PMID:37678661 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368 		JBrowse link
G Bcl2 BCL2, apoptosis regulator decreases expression
multiple interactions		 ISO
EXP		 Melitten analog results in decreased expression of BCL2 mRNA; Melitten analog results in decreased expression of BCL2 protein; Melitten results in decreased expression of BCL2 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]
Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr13:22,689,783...22,853,920
Ensembl chr13:22,684,989...22,853,743
Ensembl chr13:22,684,989...22,853,743 		JBrowse link
G Bdnf brain-derived neurotrophic factor decreases expression ISO Melitten results in decreased expression of BDNF protein CTD PMID:37678661 NCBI chr 3:96,165,042...96,215,621
Ensembl chr 3:96,165,042...96,215,615 		JBrowse link
G Birc3 baculoviral IAP repeat-containing 3 decreases expression ISO Melitten results in decreased expression of BIRC3 protein CTD PMID:21456063 NCBI chr 8:5,000,844...5,028,470
Ensembl chr 8:5,000,845...5,015,802 		JBrowse link
G Calm1 calmodulin 1 affects binding EXP Melitten binds to CALM1 protein CTD PMID:17098364 NCBI chr 6:119,487,691...119,495,759
Ensembl chr 6:119,487,621...119,498,227 		JBrowse link
G Casp3 caspase 3 increases expression
increases cleavage
decreases expression
multiple interactions		 ISO
EXP		 Melitten analog results in increased expression of CASP3 mRNA; Melitten analog results in increased expression of CASP3 protein; Melitten results in increased expression of CASP3 protein modified form
Melitten results in increased cleavage of CASP3 protein
Melitten results in decreased expression of CASP3 protein
Melitten results in increased cleavage of and results in increased activity of CASP3 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:22027265 PMID:29387245 More... NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648 		JBrowse link
G Casp8 caspase 8 increases expression ISO Melitten results in increased expression of CASP8 protein modified form CTD PMID:22027265 NCBI chr 9:60,263,863...60,312,542
Ensembl chr 9:60,264,075...60,312,542 		JBrowse link
G Casp9 caspase 9 multiple interactions
increases expression		 ISO
EXP		 Melitten results in increased cleavage of and results in increased activity of CASP9 protein
Melitten analog results in increased expression of CASP9 mRNA; Melitten analog results in increased expression of CASP9 protein
Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]		 CTD PMID:21354845 PMID:21456063 PMID:21871910 PMID:29387245 NCBI chr 5:154,108,872...154,126,628
Ensembl chr 5:154,109,046...154,126,626 		JBrowse link
G Ccnd1 cyclin D1 decreases expression ISO Melitten results in decreased expression of CCND1 protein CTD PMID:26189965 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602 		JBrowse link
G Cdh1 cadherin 1 increases secretion ISO Melitten results in increased secretion of CDH1 protein CTD PMID:22613720 NCBI chr19:34,492,371...34,561,775
Ensembl chr19:34,492,371...34,561,775 		JBrowse link
G Cdk4 cyclin-dependent kinase 4 decreases expression ISO Melitten results in decreased expression of CDK4 protein CTD PMID:26189965 NCBI chr 7:62,886,124...62,889,562
Ensembl chr 7:62,883,105...62,942,403 		JBrowse link
G Chrna7 cholinergic receptor nicotinic alpha 7 subunit multiple interactions
increases activity		 EXP Bungarotoxins inhibits the reaction [Melitten results in increased activity of CHRNA7 protein]; methyllycaconitine inhibits the reaction [Melitten results in increased activity of CHRNA7 protein] CTD PMID:19910175 NCBI chr 1:116,711,559...116,837,269
Ensembl chr 1:116,714,711...116,837,240 		JBrowse link
G Chuk component of inhibitor of nuclear factor kappa B kinase complex multiple interactions
affects binding		 ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]
Melitten binds to CHUK protein
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of CHUK protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of and results in increased activity of CHUK protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [Thioacetamide results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]		 CTD PMID:17067557 PMID:21969711 NCBI chr 1:242,959,539...242,995,066
Ensembl chr 1:242,959,760...242,995,065 		JBrowse link
G Creb1 cAMP responsive element binding protein 1 decreases phosphorylation ISO Melitten results in decreased phosphorylation of CREB1 protein CTD PMID:37678661 NCBI chr 9:65,903,511...65,972,562
Ensembl chr 9:65,903,547...65,970,816 		JBrowse link
G Cryab crystallin, alpha B multiple interactions EXP Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB mRNA]; Melitten promotes the reaction [sodium arsenite results in increased expression of CRYAB protein] CTD PMID:8591993 NCBI chr 8:51,093,441...51,099,161
Ensembl chr 8:51,093,441...51,099,157 		JBrowse link
G Dlg4 discs large MAGUK scaffold protein 4 decreases expression ISO Melitten results in decreased expression of DLG4 protein CTD PMID:37678661 NCBI chr10:54,740,700...54,769,097
Ensembl chr10:54,739,470...54,767,153 		JBrowse link
G Dnah12 dynein, axonemal, heavy chain 12 decreases expression ISO Melitten results in decreased expression of DNAH12 mRNA CTD PMID:37678661 NCBI chr16:1,936,354...2,092,663
Ensembl chr16:1,937,817...2,092,664 		JBrowse link
G Dnah17 dynein, axonemal, heavy chain 17 increases expression ISO Melitten results in increased expression of DNAH17 mRNA CTD PMID:37678661 NCBI chr10:103,244,144...103,364,953
Ensembl chr10:103,249,363...103,364,901 		JBrowse link
G Drd2 dopamine receptor D2 multiple interactions ISO Melitten inhibits the reaction [Spiperone binds to DRD2 protein] CTD PMID:20969853 NCBI chr 8:49,708,927...49,772,876
Ensembl chr 8:49,708,927...49,772,875 		JBrowse link
G Egfr epidermal growth factor receptor increases activity ISO Melitten results in increased activity of EGFR protein CTD PMID:22613720 NCBI chr14:91,176,979...91,349,722
Ensembl chr14:91,177,067...91,344,382 		JBrowse link
G Fas Fas cell surface death receptor increases expression ISO Melitten results in increased expression of FAS mRNA; Melitten results in increased expression of FAS protein CTD PMID:16974113 PMID:17854560 NCBI chr 1:231,798,963...231,832,591
Ensembl chr 1:231,798,960...231,832,591 		JBrowse link
G Fgf2 fibroblast growth factor 2 decreases expression ISO Melitten results in decreased expression of FGF2 mRNA CTD PMID:18076793 NCBI chr 2:120,236,328...120,290,673
Ensembl chr 2:120,236,328...120,291,221 		JBrowse link
G Fn1 fibronectin 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of FN1 protein] CTD PMID:21969711 NCBI chr 9:73,196,044...73,264,695
Ensembl chr 9:73,196,044...73,264,678 		JBrowse link
G Gap43 growth associated protein 43 increases phosphorylation
decreases expression		 ISO Melitten results in increased phosphorylation of GAP43 protein
Melitten results in decreased expression of GAP43 protein		 CTD PMID:9852580 PMID:37678661 NCBI chr11:58,376,371...58,470,047
Ensembl chr11:58,376,371...58,470,045 		JBrowse link
G Gli1 GLI family zinc finger 1 decreases expression ISO Melitten results in decreased expression of GLI1 protein CTD PMID:26189965 NCBI chr 7:63,156,926...63,169,579
Ensembl chr 7:63,156,926...63,169,251 		JBrowse link
G Gng11 G protein subunit gamma 11 decreases expression ISO Melitten results in decreased expression of GNG11 mRNA CTD PMID:37678661 NCBI chr 4:32,023,003...32,028,443
Ensembl chr 4:32,023,003...32,028,442 		JBrowse link
G Gnrh1 gonadotropin releasing hormone 1 multiple interactions ISO GNRH1 protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr15:41,972,482...41,976,690
Ensembl chr15:41,972,905...41,973,581
Ensembl chr15:41,972,905...41,973,581 		JBrowse link
G H19 H19 imprinted maternally expressed transcript decreases expression ISO Melitten results in decreased expression of H19 mRNA CTD PMID:34375656 NCBI chr 1:197,730,698...197,733,374
Ensembl chr 1:197,730,698...197,733,134 		JBrowse link
G Hrh2 histamine receptor H 2 increases response to substance
increases activity
multiple interactions		 EXP HRH2 protein results in increased susceptibility to Melitten
Melitten results in increased activity of HRH2 protein
Ranitidine inhibits the reaction [Melitten results in increased activity of HRH2 protein]		 CTD PMID:22995146 NCBI chr17:10,366,004...10,407,791
Ensembl chr17:10,368,298...10,407,631 		JBrowse link
G Htr1a 5-hydroxytryptamine receptor 1A multiple interactions ISO Melitten inhibits the reaction [HTR1A protein inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]] CTD PMID:11356925 NCBI chr 2:36,693,462...36,698,026
Ensembl chr 2:36,694,174...36,695,442 		JBrowse link
G Icam1 intercellular adhesion molecule 1 decreases expression ISO Melitten results in decreased expression of ICAM1 protein CTD PMID:12697458 NCBI chr 8:19,553,063...19,565,438
Ensembl chr 8:19,553,645...19,565,438 		JBrowse link
G Ikbkb inhibitor of nuclear factor kappa B kinase subunit beta multiple interactions
affects binding		 ISO Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]
Melitten binds to IKBKB protein
Dithiothreitol inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Glutathione inhibits the reaction [Melitten binds to and results in decreased activity of IKBKB protein]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Hydrogen Peroxide inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased activity of IKBKB protein]; Melitten inhibits the reaction [Nitroprusside results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]		 CTD PMID:17067557 NCBI chr16:69,319,487...69,373,251
Ensembl chr16:69,319,554...69,373,250 		JBrowse link
G Il18 interleukin 18 increases expression
multiple interactions		 ISO Melitten results in increased expression of IL18 protein
AIM2 protein promotes the reaction [Melitten results in increased expression of IL18 protein]		 CTD PMID:22973906 NCBI chr 8:50,904,630...50,932,887
Ensembl chr 8:50,906,960...50,932,887 		JBrowse link
G Il1b interleukin 1 beta multiple interactions
increases expression		 ISO
EXP		 AIM2 protein promotes the reaction [Melitten results in increased expression of IL1B protein]
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA]		 CTD PMID:17570326 PMID:21969711 PMID:22973906 NCBI chr 3:116,577,005...116,583,386
Ensembl chr 3:116,577,010...116,583,415 		JBrowse link
G Il6 interleukin 6 multiple interactions EXP
ISO		 Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein]
Melitten inhibits the reaction [Acetic Acid results in increased expression of IL6 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of IL6 protein]		 CTD PMID:17570326 PMID:21354845 PMID:21969711 PMID:33002459 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Il6r interleukin 6 receptor multiple interactions EXP Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of APAF1 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of BCL2 protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of IL6STP1 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of and results in increased activity of CASP3 protein]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP3 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 mRNA]; Melitten promotes the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of CASP9 protein] CTD PMID:21354845 NCBI chr 2:175,289,157...175,347,719
Ensembl chr 2:175,298,686...175,347,536 		JBrowse link
G Jak2 Janus kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of JAK2 protein CTD PMID:22027265 NCBI chr 1:226,995,334...227,054,381
Ensembl chr 1:226,995,334...227,054,189 		JBrowse link
G Jun Jun proto-oncogene, AP-1 transcription factor subunit multiple interactions
decreases expression		 ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of JUN protein]
Melitten results in decreased expression of JUN mRNA		 CTD PMID:20082219 PMID:37678661 NCBI chr 5:109,894,175...109,897,268
Ensembl chr 5:109,893,145...109,897,656 		JBrowse link
G Kdr kinase insert domain receptor decreases expression ISO Melitten results in decreased expression of KDR protein CTD PMID:23110475 NCBI chr14:32,217,871...32,261,018
Ensembl chr14:32,217,871...32,261,018 		JBrowse link
G Lhcgr luteinizing hormone/choriogonadotropin receptor multiple interactions ISO LHCGR protein results in increased susceptibility to [Melitten binds to CGB3 protein] CTD PMID:19261682 NCBI chr 6:5,661,871...5,728,109
Ensembl chr 6:5,661,871...5,724,521 		JBrowse link
G Map2 microtubule-associated protein 2 decreases expression ISO Melitten results in decreased expression of MAP2 protein CTD PMID:37678661 NCBI chr 9:67,723,422...67,981,886
Ensembl chr 9:67,723,371...67,979,809 		JBrowse link
G Mapk1 mitogen activated protein kinase 1 decreases phosphorylation
increases phosphorylation
multiple interactions		 ISO
EXP		 Melitten results in decreased phosphorylation of MAPK1 protein
Melitten results in increased phosphorylation of MAPK1 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK1 protein]
Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK1 protein		 CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr11:83,957,813...84,023,629
Ensembl chr11:83,957,813...84,023,616 		JBrowse link
G Mapk3 mitogen activated protein kinase 3 multiple interactions
decreases phosphorylation
increases phosphorylation		 ISO
EXP		 Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased phosphorylation of and results in increased activity of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten results in increased phosphorylation of and results in increased activity of MAPK3 protein
Melitten results in decreased phosphorylation of MAPK3 protein
Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of and results in increased activity of MAPK3 protein]
Melitten results in increased phosphorylation of MAPK3 protein		 CTD PMID:17570326 PMID:17579088 PMID:17654254 PMID:20082219 PMID:22613720 More... NCBI chr 1:181,366,646...181,372,863
Ensembl chr 1:181,366,637...181,372,863 		JBrowse link
G Mecp2 methyl CpG binding protein 2 decreases expression ISO Melitten results in decreased expression of MECP2 mRNA; Melitten results in decreased expression of MECP2 protein CTD PMID:26189965 NCBI chr  X:151,781,177...151,844,687
Ensembl chr  X:151,789,930...151,844,689 		JBrowse link
G Mmp2 matrix metallopeptidase 2 multiple interactions ISO Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein] CTD PMID:22926441 NCBI chr19:14,154,657...14,182,870
Ensembl chr19:14,154,657...14,182,870 		JBrowse link
G Mmp3 matrix metallopeptidase 3 multiple interactions ISO Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of MMP3 protein] CTD PMID:17303203 NCBI chr 8:4,640,397...4,653,963
Ensembl chr 8:4,640,416...4,653,961 		JBrowse link
G Mmp9 matrix metallopeptidase 9 multiple interactions ISO Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased activity of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of and results in increased secretion of MMP9 protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein] CTD PMID:19969058 PMID:20082219 PMID:22926441 NCBI chr 3:153,684,158...153,692,118
Ensembl chr 3:153,683,858...153,692,120 		JBrowse link
G Mt-atp6 mitochondrially encoded ATP synthase membrane subunit 6 increases expression ISO Melitten results in increased expression of ATP6 mRNA CTD PMID:37678661 NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
NCBI chr MT:7,919...8,599
Ensembl chr MT:7,919...8,599 		JBrowse link
G Mt-nd1 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 1 increases expression ISO Melitten results in increased expression of ND1 mRNA CTD PMID:37678661 NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
NCBI chr MT:2,740...3,694
Ensembl chr MT:2,740...3,694 		JBrowse link
G Mt-nd2 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 2 increases expression ISO Melitten results in increased expression of ND2 mRNA CTD PMID:37678661 NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
NCBI chr MT:3,904...4,942
Ensembl chr MT:3,904...4,942 		JBrowse link
G Mt-nd4 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4 increases expression ISO Melitten results in increased expression of ND4 mRNA CTD PMID:37678661 NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
NCBI chr MT:10,160...11,537
Ensembl chr MT:10,160...11,537 		JBrowse link
G Mt-nd4l mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4L increases expression ISO Melitten results in increased expression of ND4L mRNA CTD PMID:37678661 NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
NCBI chr MT:9,870...10,166
Ensembl chr MT:9,870...10,166 		JBrowse link
G Mt-nd5 mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5 increases expression ISO Melitten results in increased expression of ND5 mRNA CTD PMID:37678661 NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
NCBI chr MT:11,736...13,565
Ensembl chr MT:11,736...13,565 		JBrowse link
G Ndufa2 NADH:ubiquinone oxidoreductase subunit A2 decreases expression ISO Melitten results in decreased expression of NDUFA2 mRNA CTD PMID:37678661 NCBI chr18:28,355,774...28,357,863
Ensembl chr18:28,355,774...28,358,076 		JBrowse link
G Ndufb10 NADH:ubiquinone oxidoreductase subunit B10 decreases expression ISO Melitten results in decreased expression of NDUFB10 mRNA CTD PMID:37678661 NCBI chr10:13,749,273...13,751,434
Ensembl chr10:13,749,275...13,751,442 		JBrowse link
G Nfkb1 nuclear factor kappa B subunit 1 multiple interactions
decreases localization		 ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of CHUK protein]] which results in decreased localization of NFKB1 protein; [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of NFKB1 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of NFKB1 protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of NFKB1 protein]]
Melitten results in decreased localization of NFKB1 protein		 CTD PMID:15529353 PMID:17067557 PMID:18507870 PMID:21456063 NCBI chr 2:224,016,214...224,132,135
Ensembl chr 2:224,016,214...224,110,404 		JBrowse link
G Nfkbia NFKB inhibitor alpha multiple interactions ISO [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]
[Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]] which results in decreased localization of NFKB1 protein; Dithiothreitol inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Glutathione inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]]; Melitten inhibits the reaction [Lipopolysaccharides results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [Nitroprusside results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]		 CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:18507870 PMID:22926441 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941 		JBrowse link
G Nos1 nitric oxide synthase 1 decreases activity EXP Melitten results in decreased activity of NOS1 protein CTD PMID:17098364 NCBI chr12:38,615,111...38,795,492
Ensembl chr12:38,626,714...38,710,945 		JBrowse link
G Nos2 nitric oxide synthase 2 decreases expression
multiple interactions		 ISO Melitten results in decreased expression of NOS2 protein
Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of NOS2 mRNA]		 CTD PMID:15529353 PMID:17067557 PMID:17570326 PMID:21456063 NCBI chr10:63,815,308...63,851,208
Ensembl chr10:63,815,308...63,851,210 		JBrowse link
G Ntrk2 neurotrophic receptor tyrosine kinase 2 decreases phosphorylation ISO Melitten results in decreased phosphorylation of NTRK2 protein CTD PMID:37678661 NCBI chr17:5,558,992...5,870,299
Ensembl chr17:5,559,043...5,869,136 		JBrowse link
G P2rx7 purinergic receptor P2X 7 increases activity
increases response to substance		 ISO Melitten results in increased activity of P2RX7 protein
P2RX7 protein results in increased susceptibility to Melitten		 CTD PMID:22613720 NCBI chr12:33,889,709...33,934,168
Ensembl chr12:33,879,745...33,934,619 		JBrowse link
G Parp1 poly (ADP-ribose) polymerase 1 multiple interactions ISO Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein] CTD PMID:21871910 NCBI chr13:92,307,593...92,339,406
Ensembl chr13:92,307,586...92,339,404 		JBrowse link
G Pdgfrb platelet derived growth factor receptor beta multiple interactions EXP Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 NCBI chr18:54,499,962...54,538,840
Ensembl chr18:54,499,964...54,538,843 		JBrowse link
G Pla2g2a phospholipase A2 group IIA multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of PLA2G2A protein] CTD PMID:33002459 NCBI chr 5:151,076,442...151,079,019
Ensembl chr 5:151,076,442...151,079,014 		JBrowse link
G Pla2g4a phospholipase A2 group 4A decreases expression ISO Melitten results in decreased expression of PLA2G4A protein CTD PMID:21456063 NCBI chr13:61,877,818...62,022,261
Ensembl chr13:61,877,813...62,022,266 		JBrowse link
G Plcg1 phospholipase C, gamma 1 decreases phosphorylation EXP Melitten results in decreased phosphorylation of PLCG1 protein CTD PMID:17654254 NCBI chr 3:149,385,587...149,416,330
Ensembl chr 3:149,385,587...149,416,330 		JBrowse link
G Ptch1 patched 1 increases expression ISO Melitten results in increased expression of PTCH1 protein CTD PMID:26189965 NCBI chr17:1,542,705...1,607,730
Ensembl chr17:1,542,877...1,607,333 		JBrowse link
G Ptgs2 prostaglandin-endoperoxide synthase 2 multiple interactions
increases expression
decreases expression		 ISO [Melitten results in decreased expression of PTGS2 protein] which results in decreased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; SB 203580 inhibits the reaction [Melitten results in decreased expression of PTGS2 protein]
Melitten results in increased expression of PTGS2 mRNA; Melitten results in increased expression of PTGS2 protein
[Melitten results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone; Melitten inhibits the reaction [[Lipopolysaccharides results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[Nitroprusside results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of PTGS2 protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of PTGS2 mRNA]		 CTD PMID:11094054 PMID:11821123 PMID:15529353 PMID:17067557 PMID:17570326 More... NCBI chr13:62,163,936...62,172,193
Ensembl chr13:62,163,932...62,172,188 		JBrowse link
G Rab11a RAB11a, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 8:65,223,698...65,246,461
Ensembl chr 8:65,222,949...65,246,525 		JBrowse link
G Rab5a RAB5A, member RAS oncogene family multiple interactions ISO Melitten results in decreased localization of [RAB11A protein co-treated with RAB5A protein]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein] CTD PMID:22683840 NCBI chr 9:6,483,906...6,512,877
Ensembl chr 9:6,484,469...6,512,873 		JBrowse link
G Rac1 Rac family small GTPase 1 decreases activity ISO Melitten results in decreased activity of RAC1 protein CTD PMID:18506888 NCBI chr12:11,037,028...11,057,251
Ensembl chr12:11,036,698...11,057,251 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions
decreases localization		 ISO
EXP		 Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; Melitten inhibits the reaction [Tetradecanoylphorbol Acetate results in increased localization of RELA protein]; Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased localization of and results in increased activity of RELA protein]
Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of and results in increased activity of RELA protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]; Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Lipopolysaccharides results in increased localization of RELA protein]]; pyrazolanthrone inhibits the reaction [Melitten inhibits the reaction [Nitroprusside results in increased localization of RELA protein]]
Melitten results in decreased localization of RELA protein		 CTD PMID:17570326 PMID:18507870 PMID:20082219 PMID:21354845 PMID:21456063 More... NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Scn10a sodium voltage-gated channel alpha subunit 10 increases expression
multiple interactions		 EXP Melitten results in increased expression of SCN10A mRNA; Melitten results in increased expression of SCN10A protein
[Melitten results in increased expression of SCN10A protein] which results in increased transport of Sodium		 CTD PMID:23264124 NCBI chr 8:119,350,723...119,462,882
Ensembl chr 8:119,350,724...119,462,614 		JBrowse link
G Scn11a sodium voltage-gated channel alpha subunit 11 increases expression
multiple interactions
increases response to substance		 EXP Melitten results in increased expression of SCN11A mRNA; Melitten results in increased expression of SCN11A protein
[Melitten results in increased expression of SCN11A protein] which results in increased transport of Sodium
SCN11A protein results in increased susceptibility to Melitten		 CTD PMID:23264124 NCBI chr 8:119,495,550...119,567,044
Ensembl chr 8:119,496,769...119,567,044 		JBrowse link
G Sdhc succinate dehydrogenase complex subunit C decreases expression ISO Melitten results in decreased expression of SDHC mRNA CTD PMID:37678661 NCBI chr13:83,544,652...83,565,560
Ensembl chr13:83,544,652...83,566,253 		JBrowse link
G Shh sonic hedgehog signaling molecule decreases expression ISO Melitten results in decreased expression of SHH protein CTD PMID:26189965 NCBI chr 4:6,954,017...6,963,170
Ensembl chr 4:6,954,017...6,963,170 		JBrowse link
G Slc6a3 solute carrier family 6 member 3 increases localization
multiple interactions		 ISO Melitten results in increased localization of SLC6A3 protein
Cocaine inhibits the reaction [Melitten results in increased localization of SLC6A3 protein]; Melitten inhibits the reaction [2beta-carbomethoxy-3beta-(4-iodophenyl)tropane binds to SLC6A3 protein]; Melitten inhibits the reaction [SLC6A3 protein results in increased uptake of Dopamine]; Melitten results in increased localization of [SLC6A3 protein co-treated with RAB5A protein]		 CTD PMID:20969853 PMID:22683840 NCBI chr 1:29,709,443...29,750,413
Ensembl chr 1:29,709,443...29,750,413 		JBrowse link
G Socs3 suppressor of cytokine signaling 3 decreases expression ISO Melitten results in decreased expression of SOCS3 mRNA CTD PMID:37678661 NCBI chr10:103,193,909...103,197,322
Ensembl chr10:103,193,537...103,197,787 		JBrowse link
G Stat3 signal transducer and activator of transcription 3 decreases phosphorylation
multiple interactions		 ISO
EXP		 Melitten results in decreased phosphorylation of STAT3 protein
Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased expression of STAT3 mRNA]; Melitten inhibits the reaction [[IL6 protein co-treated with IL6R protein] results in increased phosphorylation of and results in increased activity of STAT3 protein]
TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]; TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]		 CTD PMID:21354845 PMID:22027265 NCBI chr10:85,811,206...85,863,057
Ensembl chr10:85,811,218...85,863,057 		JBrowse link
G Syp synaptophysin decreases expression ISO Melitten results in decreased expression of SYP protein CTD PMID:37678661 NCBI chr  X:14,849,444...14,864,553
Ensembl chr  X:14,849,444...14,864,745 		JBrowse link
G Tbxa2r thromboxane A2 receptor increases response to substance EXP TBXA2R protein results in increased susceptibility to Melitten CTD PMID:16524625 NCBI chr 7:8,383,347...8,390,753
Ensembl chr 7:8,383,378...8,388,176 		JBrowse link
G Tgfa transforming growth factor alpha increases secretion ISO Melitten results in increased secretion of TGFA protein CTD PMID:22613720 NCBI chr 4:118,618,043...118,700,897
Ensembl chr 4:118,618,269...118,700,894 		JBrowse link
G Tgfb1 transforming growth factor, beta 1 multiple interactions
decreases activity		 ISO Melitten affects the reaction [TGFB1 protein affects the localization of APAF1 protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BAX protein]; Melitten affects the reaction [TGFB1 protein affects the localization of BCL2 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP3 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of CASP9 protein]; Melitten inhibits the reaction [TGFB1 protein results in increased cleavage of PARP1 protein]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TGFB1 protein]
Melitten results in decreased activity of TGFB1 protein		 CTD PMID:21871910 PMID:21969711 NCBI chr 1:81,196,532...81,212,848
Ensembl chr 1:81,196,532...81,212,847 		JBrowse link
G Tlr4 toll-like receptor 4 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TLR4 protein] CTD PMID:33002459 NCBI chr 5:80,145,867...80,159,501
Ensembl chr 5:80,145,826...80,159,628 		JBrowse link
G Tnf tumor necrosis factor multiple interactions
decreases secretion
increases expression		 ISO
EXP		 Melitten inhibits the reaction [TNF protein affects the localization of RELA protein]; Melitten inhibits the reaction [TNF protein results in increased degradation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 mRNA]; Melitten inhibits the reaction [TNF protein results in increased expression of MMP9 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of AKT1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK1 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of MAPK3 protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP2 protein]; Melitten inhibits the reaction [TNF protein results in increased secretion of MMP9 protein]
Melitten results in decreased secretion of TNF protein
Melitten inhibits the reaction [TNF protein results in increased expression of IL1B protein]; Melitten inhibits the reaction [TNF protein results in increased expression of IL6 protein]
Melitten results in increased expression of TNF mRNA
Melitten inhibits the reaction [[TNF protein results in increased expression of NOS2 protein] which results in increased chemical synthesis of Nitric Oxide]; Melitten inhibits the reaction [[TNF protein results in increased expression of PTGS2 protein] which results in increased chemical synthesis of Dinoprostone]; Melitten inhibits the reaction [Acetic Acid results in increased expression of TNF protein]; Melitten inhibits the reaction [Lipopolysaccharides results in increased expression of TNF mRNA]; Melitten inhibits the reaction [Thioacetamide results in increased expression of TNF protein]; Melitten inhibits the reaction [TNF protein results in increased activity of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased activity of IKBKB protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of CHUK protein]; Melitten inhibits the reaction [TNF protein results in increased phosphorylation of NFKBIA protein]		 CTD PMID:11094054 PMID:11821123 PMID:17067557 PMID:17570326 PMID:21969711 More... NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
G Tnfrsf10b TNF receptor superfamily member 10b multiple interactions
increases expression
affects response to substance		 ISO TNFRSF10A protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
Melitten results in increased expression of TNFRSF10A mRNA
TNFRSF10A protein affects the susceptibility to Melitten		 CTD PMID:22027265 NCBI chr15:44,840,386...44,868,318
Ensembl chr15:44,840,386...44,867,467 		JBrowse link
G Tnfrsf21 TNF receptor superfamily member 21 increases expression
affects response to substance
multiple interactions		 ISO Melitten results in increased expression of TNFRSF21 mRNA
TNFRSF21 protein affects the susceptibility to Melitten
TNFRSF21 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]		 CTD PMID:22027265 NCBI chr 9:17,879,156...17,954,085
Ensembl chr 9:17,879,156...17,954,085 		JBrowse link
G Tnfrsf25 TNF receptor superfamily member 25 increases expression
multiple interactions
affects response to substance		 ISO Melitten results in increased expression of TNFRSF25 mRNA
TNFRSF25 protein affects the reaction [Melitten results in decreased phosphorylation of STAT3 protein]
TNFRSF25 protein affects the susceptibility to Melitten		 CTD PMID:22027265 NCBI chr 5:162,621,669...162,626,341
Ensembl chr 5:162,622,075...162,626,341 		JBrowse link
G Traf6 TNF receptor associated factor 6 multiple interactions ISO Melitten inhibits the reaction [Acetic Acid results in increased expression of TRAF6 protein] CTD PMID:33002459 NCBI chr 3:87,963,517...87,988,316
Ensembl chr 3:87,963,514...87,983,507 		JBrowse link
G Trpv1 transient receptor potential cation channel, subfamily V, member 1 multiple interactions
increases response to substance
increases activity		 EXP [Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium; capsazepine inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; capsazepine inhibits the reaction [TRPV1 protein results in increased susceptibility to Melitten]; Indomethacin inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; Masoprocol inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium]; N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[Melitten results in increased activity of TRPV1 protein] which results in increased transport of Calcium] CTD PMID:16446039 PMID:21453681 NCBI chr10:57,851,428...57,876,513
Ensembl chr10:57,851,428...57,876,513 		JBrowse link
G Uqcrfs1 ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 decreases expression ISO Melitten results in decreased expression of UQCRFS1 mRNA CTD PMID:37678661 NCBI chr17:33,977,908...33,982,478
Ensembl chr17:33,977,921...33,982,479 		JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions ISO Melitten inhibits the reaction [Thioacetamide results in increased expression of VCAM1 protein] CTD PMID:21969711 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958 		JBrowse link
G Vdac1 voltage-dependent anion channel 1 increases expression ISO Melitten results in increased expression of VDAC1 protein CTD PMID:34375656 NCBI chr10:36,532,306...36,559,642
Ensembl chr10:36,532,244...36,559,640 		JBrowse link
G Vegfa vascular endothelial growth factor A multiple interactions
decreases expression		 ISO SB 203580 inhibits the reaction [Melitten results in decreased expression of VEGFA protein]
Melitten results in decreased expression of VEGFA mRNA; Melitten results in decreased expression of VEGFA protein		 CTD PMID:18076793 PMID:23110475 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641 		JBrowse link
G Xiap X-linked inhibitor of apoptosis decreases expression ISO Melitten results in decreased expression of XIAP protein CTD PMID:21456063 NCBI chr  X:120,890,537...120,938,413
Ensembl chr  X:120,897,907...120,934,700 		JBrowse link
G Xist X inactive specific transcript increases expression ISO Melitten results in increased expression of XIST mRNA CTD PMID:34375656 NCBI chr  X:68,474,987...68,492,500 JBrowse link
Neurokinin A term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Tacr2 tachykinin receptor 2 affects binding ISO Neurokinin A binds to TACR2 protein CTD PMID:15925360 NCBI chr20:30,208,907...30,223,446
Ensembl chr20:30,208,907...30,223,446 		JBrowse link
nisin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Snai1 snail family transcriptional repressor 1 decreases expression ISO Nisin results in decreased expression of SNAI1 mRNA CTD PMID:36084725 NCBI chr 3:156,248,479...156,252,969
Ensembl chr 3:156,248,485...156,252,969 		JBrowse link
G Twist1 twist family bHLH transcription factor 1 decreases expression ISO Nisin results in decreased expression of TWIST1 mRNA CTD PMID:36084725 NCBI chr 6:50,674,910...50,676,904
Ensembl chr 6:50,674,678...50,677,653 		JBrowse link
nociceptin term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Oprl1 opioid related nociceptin receptor 1 multiple interactions
affects binding		 ISO Endocannabinoids inhibits the reaction [Nociceptin binds to and results in increased activity of OPRL1 protein]; Nociceptin binds to and results in increased activity of OPRL1 protein
Nociceptin binds to OPRL1 protein		 CTD PMID:20359694 PMID:21866885 PMID:30102254 NCBI chr 3:168,831,934...168,839,920
Ensembl chr 3:168,834,003...168,839,920 		JBrowse link
omega-conotoxin GVIA term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Clu clusterin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [methoxyacetic acid results in increased expression of and results in increased secretion of CLU protein] CTD PMID:14656996 NCBI chr15:40,161,068...40,200,315
Ensembl chr15:40,174,617...40,200,315 		JBrowse link
G Fos Fos proto-oncogene, AP-1 transcription factor subunit multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride affects the expression of FOS mRNA] CTD PMID:20211981 NCBI chr 6:105,121,170...105,124,036
Ensembl chr 6:105,121,170...105,124,036 		JBrowse link
G Kcna1 potassium voltage-gated channel subfamily A member 1 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] promotes the reaction [Potassium Chloride results in increased expression of KCNA1 mRNA] CTD PMID:20211981 NCBI chr 4:159,464,223...159,472,905
Ensembl chr 4:159,464,188...159,472,682 		JBrowse link
G Kcnc3 potassium voltage-gated channel subfamily C member 3 multiple interactions EXP [Nifedipine co-treated with omega-Conotoxin GVIA co-treated with omega-Agatoxin IVA] inhibits the reaction [Potassium Chloride results in increased expression of KCNC3 mRNA] CTD PMID:20211981 NCBI chr 1:95,080,960...95,095,165
Ensembl chr 1:95,080,960...95,095,160 		JBrowse link
G Sct secretin multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium Chloride results in increased secretion of SCT protein] CTD PMID:16888165 NCBI chr 1:196,382,857...196,383,668
Ensembl chr 1:196,382,856...196,383,658 		JBrowse link
G Snca synuclein alpha multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [SNCA protein results in increased uptake of Calcium] CTD PMID:17179863 NCBI chr 4:89,696,420...89,797,240
Ensembl chr 4:89,696,420...89,796,262 		JBrowse link
G Tac1 tachykinin, precursor 1 multiple interactions EXP omega-Conotoxin GVIA inhibits the reaction [Potassium results in increased secretion of TAC1 protein modified form] CTD PMID:2325850 NCBI chr 4:35,679,183...35,687,180
Ensembl chr 4:35,679,704...35,687,178 		JBrowse link
oxidised LDL term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Map3k7 mitogen activated protein kinase kinase kinase 7 multiple interactions
increases phosphorylation		 ISO Albiflorin inhibits the reaction [oxidized LDL increases phosphorylation of MAP3K7 protein in umbilical vein endothelial cells]
Oxidized LDL increases phosphorylation of MAP3K7 protein in umbilical vein endothelial cells		 RGD PMID:35601145 PMID:35601145 RGD:155804296, RGD:155804296 NCBI chr 5:46,356,973...46,415,597
Ensembl chr 5:46,357,931...46,415,597 		JBrowse link
G Nr1h3 nuclear receptor subfamily 1, group H, member 3 decreases expression
increases expression 		ISO Oxidized LDL decreases expression of Nr1h3 mRNA and protein in vascular smooth muscle cells
Oxidized LDL increases expression of NR1H3 protein in macrophages		 RGD PMID:27807703 PMID:32780606 RGD:401850553, RGD:401850600 NCBI chr 3:77,158,808...77,168,907
Ensembl chr 3:77,158,808...77,168,722 		JBrowse link
G Phactr1 phosphatase and actin regulator 1 increases expression
decreases expression 		ISO Oxidized low-density lipoprotein increases expression of PHACTR1 mRNA in umbilical vein endothelial cells
Oxidized low density lipoprotein increases expression of short length PHACTR1 mRNA in macrophages
Oxidized low density lipoprotein decreases expression of intermediate length PHACTR1 mRNA in macrophages		 RGD PMID:36091033 PMID:27187934 PMID:27187934 RGD:401900131, RGD:401900169, RGD:401900169 NCBI chr17:21,560,364...22,040,166
Ensembl chr17:21,562,721...22,039,831 		JBrowse link
G Ptgis prostaglandin I2 synthase decreases expression ISO Oxidized LDL decreases expression of PTGIS mRNA in aortic endothelial cells and aortic smooth muscle cells RGD PMID:22112851 RGD:401959395 NCBI chr 3:155,928,564...155,964,228
Ensembl chr 3:155,916,412...155,965,451 		JBrowse link
G Ptpn1 protein tyrosine phosphatase, non-receptor type 1 increases expression ISO Oxidized-LDL increases expression of PTPN1 mRNA and protein in endothelial cell of umbilical vein RGD PMID:35747159 RGD:401976383 NCBI chr 3:156,638,811...156,687,503
Ensembl chr 3:156,638,769...156,687,504 		JBrowse link
PR-39 term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Icam1 intercellular adhesion molecule 1 multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein] CTD PMID:12388057 NCBI chr 8:19,553,063...19,565,438
Ensembl chr 8:19,553,645...19,565,438 		JBrowse link
G Sele selectin E multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein] CTD PMID:12388057 NCBI chr13:76,402,841...76,412,741
Ensembl chr13:76,403,304...76,412,741 		JBrowse link
G Tnf tumor necrosis factor multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of ICAM1 protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of SELE protein]; PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
G Vcam1 vascular cell adhesion molecule 1 multiple interactions ISO PR 39 inhibits the reaction [TNF protein results in increased expression of VCAM1 protein] CTD PMID:12388057 NCBI chr 2:204,038,120...204,057,852
Ensembl chr 2:204,038,114...204,057,958 		JBrowse link
royal jelly term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Bax BCL2 associated X, apoptosis regulator multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in decreased expression of BAX protein] CTD PMID:34227456 NCBI chr 1:95,940,001...95,945,407
Ensembl chr 1:95,938,808...95,945,368 		JBrowse link
G Bcl2 BCL2, apoptosis regulator multiple interactions ISO
EXP		 royal jelly inhibits the reaction [Nicotine results in decreased expression of BCL2 mRNA]
royal jelly inhibits the reaction [Fluorides results in increased expression of BCL2 protein]		 CTD PMID:30896085 PMID:34227456 NCBI chr13:22,689,783...22,853,920
Ensembl chr13:22,684,989...22,853,743
Ensembl chr13:22,684,989...22,853,743 		JBrowse link
G Bdnf brain-derived neurotrophic factor multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in decreased expression of BDNF protein] CTD PMID:34227456 NCBI chr 3:96,165,042...96,215,621
Ensembl chr 3:96,165,042...96,215,615 		JBrowse link
G Casp3 caspase 3 multiple interactions ISO
EXP		 royal jelly inhibits the reaction [Nicotine results in increased expression of CASP3 mRNA]
royal jelly inhibits the reaction [Fluorides results in decreased expression of CASP3 protein]		 CTD PMID:30896085 PMID:34227456 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648 		JBrowse link
G Casp6 caspase 6 multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in decreased expression of CASP6 protein] CTD PMID:34227456 NCBI chr 2:218,466,063...218,478,503
Ensembl chr 2:218,466,076...218,478,502 		JBrowse link
G Casp9 caspase 9 multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in decreased expression of CASP9 protein] CTD PMID:34227456 NCBI chr 5:154,108,872...154,126,628
Ensembl chr 5:154,109,046...154,126,626 		JBrowse link
G Cat catalase multiple interactions EXP
ISO		 royal jelly inhibits the reaction [Cisplatin results in decreased activity of CAT protein]; royal jelly inhibits the reaction [Fluorides results in decreased activity of CAT protein]
royal jelly inhibits the reaction [Nicotine results in decreased activity of CAT protein]		 CTD PMID:20369241 PMID:30896085 PMID:34227456 NCBI chr 3:89,842,393...89,874,577
Ensembl chr 3:89,842,399...89,874,478 		JBrowse link
G Ccnd1 cyclin D1 multiple interactions ISO royal jelly inhibits the reaction [phenylhydrazine affects the expression of CCND1 mRNA] CTD PMID:35099105 NCBI chr 1:200,089,002...200,098,524
Ensembl chr 1:200,089,002...200,098,602 		JBrowse link
G E2f1 E2F transcription factor 1 multiple interactions EXP royal jelly inhibits the reaction [Paclitaxel results in increased expression of E2F1 mRNA] CTD PMID:27496854 NCBI chr 3:143,064,535...143,075,362
Ensembl chr 3:143,049,478...143,075,361 		JBrowse link
G Esr1 estrogen receptor 1 multiple interactions
affects binding
increases activity		 ISO Estradiol inhibits the reaction [royal jelly binds to ESR1 protein]; royal jelly binds to and results in increased activity of ESR1 protein; royal jelly inhibits the reaction [Estradiol binds to ESR1 protein]
royal jelly results in increased activity of ESR1 protein		 CTD PMID:15946813 PMID:17287592 NCBI chr 1:41,106,335...41,499,104
Ensembl chr 1:41,210,475...41,495,002 		JBrowse link
G Esr2 estrogen receptor 2 multiple interactions
affects binding		 ISO Estradiol inhibits the reaction [royal jelly binds to ESR2 protein]; royal jelly binds to and results in increased activity of ESR2 protein; royal jelly inhibits the reaction [Estradiol binds to ESR2 protein] CTD PMID:15946813 PMID:17287592 NCBI chr 6:94,858,438...94,909,630
Ensembl chr 6:94,809,547...94,908,919 		JBrowse link
G Gsk3b glycogen synthase kinase 3 beta multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in increased expression of GSK3B protein] CTD PMID:34227456 NCBI chr11:62,498,997...62,648,665
Ensembl chr11:62,504,316...62,648,646 		JBrowse link
G Ins1 insulin 1 multiple interactions EXP royal jelly inhibits the reaction [Fructose results in increased expression of INS1 protein] CTD PMID:18981581 NCBI chr 1:251,244,973...251,245,540
Ensembl chr 1:251,244,973...251,245,536 		JBrowse link
G Myc MYC proto-oncogene, bHLH transcription factor multiple interactions
decreases expression		 ISO
EXP		 royal jelly inhibits the reaction [phenylhydrazine results in decreased expression of MYC mRNA]
royal jelly inhibits the reaction [Paclitaxel results in decreased expression of MYC mRNA]
royal jelly results in decreased expression of MYC mRNA		 CTD PMID:27496854 PMID:35099105 NCBI chr 7:93,593,705...93,598,633
Ensembl chr 7:93,593,705...93,598,630 		JBrowse link
G Nfe2l2 NFE2 like bZIP transcription factor 2 multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in decreased expression of NFE2L2 protein] CTD PMID:34227456 NCBI chr 3:60,594,239...60,621,712
Ensembl chr 3:60,594,242...60,621,737 		JBrowse link
G Pcna proliferating cell nuclear antigen multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in decreased expression of PCNA protein] CTD PMID:30896085 NCBI chr 3:119,499,039...119,502,911
Ensembl chr 3:119,498,810...119,502,995 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions EXP royal jelly inhibits the reaction [Fluorides results in increased expression of RELA protein] CTD PMID:34227456 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Tff1 trefoil factor 1 increases expression ISO royal jelly results in increased expression of TFF1 mRNA CTD PMID:15946813 NCBI chr20:9,235,736...9,239,597
Ensembl chr20:9,235,736...9,239,597 		JBrowse link
G Tp53 tumor protein p53 multiple interactions ISO royal jelly inhibits the reaction [Nicotine results in increased expression of TRP53 mRNA] CTD PMID:30896085 NCBI chr10:54,300,070...54,311,525
Ensembl chr10:54,300,048...54,311,524 		JBrowse link
G Vegfa vascular endothelial growth factor A increases expression ISO
EXP		 royal jelly results in increased expression of VEGFA mRNA CTD PMID:15946813 PMID:17287592 NCBI chr 9:14,955,300...14,970,641
Ensembl chr 9:14,955,300...14,970,641 		JBrowse link
semaglutide term browser
Symbol Object Name Qualifiers Evidence Notes Source PubMed Reference(s) RGD Reference(s) Position
G Bcl2 BCL2, apoptosis regulator multiple interactions ISO
EXP		 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in decreased expression of BCL2 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in decreased expression of BCL2 protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in decreased expression of BCL2 protein] CTD PMID:36075570 NCBI chr13:22,689,783...22,853,920
Ensembl chr13:22,684,989...22,853,743
Ensembl chr13:22,684,989...22,853,743 		JBrowse link
G Casp3 caspase 3 multiple interactions ISO
EXP		 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased cleavage of CASP3 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased cleavage of CASP3 protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in increased cleavage of CASP3 protein] CTD PMID:36075570 NCBI chr16:45,662,910...45,681,171
Ensembl chr16:45,662,910...45,684,648 		JBrowse link
G Hdac5 histone deacetylase 5 multiple interactions EXP
ISO		 semaglutide inhibits the reaction [Lipopolysaccharides results in increased expression of HDAC5 protein]
[Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased expression of HDAC5 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in decreased expression of BCL2 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased cleavage of CASP3 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of RELA protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of IL6 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in increased expression of HDAC5 protein]		 CTD PMID:36075570 NCBI chr10:87,152,978...87,187,921
Ensembl chr10:87,152,978...87,188,235 		JBrowse link
G Il6 interleukin 6 multiple interactions ISO
EXP		 [Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of IL6 protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of IL6 protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of IL6 protein]
semaglutide inhibits the reaction [Lipopolysaccharides results in increased expression of IL6 protein]		 CTD PMID:36075570 NCBI chr 4:5,214,602...5,219,178
Ensembl chr 4:5,213,394...5,219,178 		JBrowse link
G Nfkbia NFKB inhibitor alpha multiple interactions ISO [Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of NFKBIA protein] CTD PMID:36075570 NCBI chr 6:72,858,713...72,861,941
Ensembl chr 6:72,858,712...72,861,941 		JBrowse link
G Rela RELA proto-oncogene, NF-kB subunit multiple interactions ISO [Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of RELA protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of RELA protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of RELA protein] CTD PMID:36075570 NCBI chr 1:202,925,001...202,935,484
Ensembl chr 1:202,924,945...202,935,484 		JBrowse link
G Tnf tumor necrosis factor multiple interactions EXP
ISO		 semaglutide inhibits the reaction [Lipopolysaccharides results in increased expression of TNF protein]
[Tetradecanoylphorbol Acetate co-treated with Calcimycin] inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]]; HDAC5 protein inhibits the reaction [semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]]; semaglutide inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]		 CTD PMID:36075570 NCBI chr20:3,622,011...3,624,629
Ensembl chr20:3,622,011...3,624,629 		JBrowse link
Term paths to the root
Path 1
Term Annotations click to browse term
  CHEBI ontology 19922
    chemical entity 19920
      molecular entity 19920
        polyatomic entity 19877
          macromolecule 8809
            polypeptide 327
              (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
              (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
              (6S)-N-[4-amino-1-[[1-[[4-amino-1-oxo-1-[[6,9,18-tris(2-aminoethyl)-3-(1-hydroxyethyl)-15-(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-12-propan-2-yl-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxobutan-2-yl]-6-methyloctanamide 0
              2-[2-[2-[[2-[[2-[[2-[[2-[2-[[5-(diaminomethylideneamino)-2-[[2-methyl-2-[[3-methyl-2-[2-[[2-methyl-2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]butanoyl]amino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoylamino]propanoylamino]-2-methylpropanoic acid 0
              2-[2-[[2-[[2-[[2-[[2-[2-[[5-(diaminomethylideneamino)-2-[[2-methyl-2-[[3-methyl-2-[2-[[2-methyl-2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]butanoyl]amino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoylamino]propanoic acid 0
              2-[[2-[[2-[[2-[[2-[2-[[5-carbamimidamido-2-[[2-methyl-2-[2-[2-[[2-methyl-2-[2-[[4-methyl-2-[[2-methyl-2-[2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoylamino]propanoyl]amino]pentanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]propanoylamino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoic acid 0
              Aborycin 0
              Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
              Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
              Acidocin J-1132beta 0
              Actagardine B 0
              Actagardine, oxidised form 0
              Actagardine, unoxidised form 0
              Aibellin 0
              Ampullosporin 77
              Ampullosporin B 0
              Ampullosporin C 0
              Ampullosporin D 0
              Ampullosporin E1 0
              Ampullosporin E2 0
              Ampullosporin E3 0
              Ampullosporin E4 0
              Amychelin B 0
              Anafp 0
              Andalusicin A 0
              Arthrofactin 0
              Atroviridin A 0
              Atroviridin B 0
              Atroviridin-Catr 0
              Azotobactin delta 0
              BI-32169 0
              Bavaricin A 0
              Bogorol A 0
              Bonsecamin 0
              Burrioplantin A 0
              CIGB-300 0
              Cacaoidin 0
              Catenulipeptin 0
              Cerexin B 0
              Cerexin-D2 0
              Cerexin-D3 0
              Cerexin-D4 0
              Cervinin 59-acetate 0
              Chitinimide A 0
              Chitinimide B 0
              Chitinimide E 0
              Chitinimide F 0
              Chrysaibol 0
              Chrysospermin A 0
              Chrysospermin B 0
              Chrysospermin C 0
              Chrysospermin D 0
              Cinnamomin 0
              Cinnapeptin 0
              Citrocin 0
              Cittilin A 0
              ComXRO-B-2 pheromone 0
              Corbomycin 0
              Curvopeptin-2 0
              Curvopeptin-3 0
              Curvopeptin-4 0
              Curvopeptin-5 0
              Curvopeptin-6 0
              Cyanochelin A 0
              Cypemycin 0
              DASKALRSSGMP 0
              DKATIGFEVQEE 0
              DSGEGDFLAEGGGVR 0
              Daspyromycin A 0
              Daspyromycin B 0
              Deacyl-GP1416 0
              Deepginsen 0
              Deoxyactagardine B 0
              Divercin V41 0
              ENPAVHFFKNIVTPRTP 0
              ENPVVAFFKNIVTPRTP 0
              ENPVVHFFFNIVTPRTP 0
              ENPVVHFFKNIVTPRTP 0
              ENPVVHFFYNIVTPRTP 0
              Endopyrrole B 0
              Enterocin CRL 35 0
              Enterocin EJ97 0
              Enterolysin A 0
              FPAWFTKLYPRT 0
              FR901451 0
              Fabrubactin A 0
              Fabrubactin B 0
              Faulknamycin 0
              Feglymycin 0
              Felipeptin A1 0
              Felipeptin A2 0
              Fulvocin C 0
              Fungal ferritin 0
              Fusaoctaxin A 0
              GP6738 0
              Gabetaericin B1 0
              Gabetaericin B3 0
              Gallidermin 0
              Glomerella cingulata peptide 0
              Goadpeptin B 0
              Goadvionin A1 0
              Goadvionin A2 0
              Goadvionin A3 0
              Goadvionin A4 0
              Goadvionin B1 0
              Goadvionin B2 0
              Goadvionin B3 0
              Goadvionin B4 0
              Gonadorelin hydrochloride 0
              Grimoviridin 0
              GsMTx4 0
              Haereoplantin A 0
              Haereoplantin B 0
              Haereoplantin E 0
              Halovir I 0
              Halovir J 0
              Halovir K 0
              Harpin 0
              Harzianin HC-6 0
              Harzianin PCu 4 0
              Heinamide B2 0
              Heinamide B3 0
              Holrhizin E 0
              Holrhizin F 0
              Holrhizin G 0
              Holrhizin K 0
              Holrhizin M 0
              Holrhizin N 0
              Holrhizin O 0
              Holrhizin P 0
              Holrhizin Q 0
              Huascopeptin 0
              Hypelcin B-I 0
              Hypelcin B-II 0
              Hypelcin B-III 0
              Hypelcin B-IV 0
              Hypelcin B-V 0
              Hypomurocin A-3 0
              Hypomurocin A-4 0
              Hypomurocin A-5 0
              Hypomurocin A-5a 0
              Hypomurocin B-1 0
              Hypomurocin B-2 0
              Hypomurocin B-3a 0
              Hypomurocin B-3b 0
              Hypomurocin B-4 0
              Hypomurocin B-5 0
              IPQVWRDWFKLP 0
              Iso-faulknamycin 0
              JNK inhibitor I 0
              KGKGKGKGKGENPAVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVAFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFFNIVTPRTP 0
              KGKGKGKGKGENPVVHFFKNIVTPRTP 0
              KGKGKGKGKGENPVVHFFYNIVTPRTP 0
              Kolobetain A 0
              Kyamicin 0
              LP237-F5 0
              LP237-F7 0
              LP237-F8 0
              LSM-37009 0
              LSM-37015 0
              LSM-37045 0
              LSM-37094 0
              LSM-37129 0
              LSM-37138 0
              LSM-37175 0
              LSM-37192 0
              LSM-37213 0
              Labetaomycin 0
              Lacticin 481 0
              Lactococcin mmfii 0
              Lariatin A 0
              Lariatin B 0
              Laxaphycin B5 0
              Laxaphycin B6 0
              Leucinostatin NPDG A 0
              Leucinostatin NPDG B 0
              Leucocin B-TA33a 0
              Leucocin C-TA33a 0
              Ling Zhi-8 0
              Linocin M18 0
              Lyngbyazothrin A 0
              Lyngbyazothrin B 0
              Lyngbyazothrin C 0
              Lyngbyazothrin D 0
              Marinomonasin 0
              Marinostatin 0
              Michiganin A 0
              Microcin J25 0
              Microviridin C 0
              Microviridin D 0
              Microviridin E 0
              Microviridin F 0
              Microviridin H 0
              Microviridin SD-1684 0
              Mirabamide C 0
              Mirabamide G 0
              Mirabamide H 0
              Misaugamycin A 0
              Misaugamycin B 0
              Myxarylin 0
              N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
              N-[4-amino-1-[[1-[[4-amino-1-oxo-1-[[6,9,18-tris(2-aminoethyl)-3-(1-hydroxyethyl)-15-(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-12-propan-2-yl-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxobutan-2-yl]-6-methylheptanamide 0
              N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
              Neoatroviridin A 0
              Neoatroviridin B 0
              Neoatroviridin D 0
              Neurokinin A 1
              Neurokinin B 0
              Nisin Z 0
              Nocathioamide A 0
              Nocathioamide B 0
              Nocathioamide C 0
              P-factor 0
              PA48009 0
              POH 1 0
              POH 2 0
              POH 3 0
              Paenithopeptin A 0
              Paenithopeptin B 0
              Paenithopeptin C 0
              Paenithopeptin D 0
              Paenithopeptin E 0
              Paracelsin E 0
              Parasiticein 0
              Pholipeptin 0
              Piscicolin-61 0
              Planosporicin 0
              Plantaricin W 0
              Plw-alpha 0
              Polymyxin B1 Sulfate 0
              Polymyxin B5 0
              Polymyxin B6 0
              Polymyxin E4 0
              Polymyxin E7 0
              Polymyxin Ile-E8 0
              Polymyxin Nva-E1 0
              Polymyxin Nva-E2 0
              Polymyxin-P1 0
              Polysporin A 0
              Polysporin B 0
              Polysporin C 0
              Polysporin D 0
              Polytheonamide A 0
              Polytheonamide B 0
              Potashchelin A 0
              Potashchelin B 0
              Potashchelin C 0
              Potashchelin D 0
              Pristinin A3 0
              Propeptin 0
              Propeptin-2 0
              Prunipeptin 0
              Pseudoalteropeptide A 0
              Pseudodesmin C 0
              Pseudovibriamide A1 0
              Pseudovibriamide A3 0
              Pseudovibriamide A5 0
              Pseudovibriamide A6 0
              QINTAKWWKTHF 0
              QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
              Quinoisobutyride A 0
              RES-701-2 0
              RES-701-3 0
              RES-701-4 0
              Rac1 Inhibitor W56 0
              Rimomycin A 0
              Rimomycin B 0
              Rimomycin C 0
              Ririwpeptide A 0
              Ririwpeptide B 0
              Rotihibin C 0
              Rotihibin D 0
              SN50 0
              SPF-5506-A4 0
              STAT3 inhibitor peptide 0
              Sakacin 674 0
              Salivaricin B 0
              Salivaricin P 0
              Scytocyclamide B 0
              Scytocyclamide B2 0
              Scytocyclamide B3 0
              Scytocyclamide C 0
              Scytovirin 0
              Septocylindrin A 0
              Septocylindrin B 0
              Streptamidine 0
              Streptomonomicin 0
              Streptomyces coelicolor calcium-dependent antibiotic CDA4b 0
              Streptosactin 0
              Sungsanpin 0
              Syringafactin A 0
              Syringafactin B 0
              Syringafactin C 0
              Syringafactin D 0
              Syringafactin F 0
              Thanafactin A 0
              Thioalbamide 0
              Thiostreptamide S4 0
              Thiostreptamide S87 0
              Thuricin 439A 0
              Tolybybetaidin A 0
              Tolybybetaidin B 0
              Trichobrachin-IB 0
              Trichobrachin-IIA 0
              Trichocellin-A-III 0
              Trichocellin-A-IV 0
              Trichocellin-A-V 0
              Trichocellin-A-VI 0
              Trichocellin-A-VII 0
              Trichocellin-A-VIII 0
              Trichocellin-B-I 0
              Trichocellin-B-II 0
              Trichogin A IV 0
              Trichokindin-IIIb 0
              Trichokindin-IIa 0
              Trichokindin-Ia 0
              Trichokindin-Ib 0
              Trichokonin V 0
              Trichokonin-IX 0
              Trichokonin-Ia 0
              Trichokonin-Ib 0
              Trichokonin-VII 0
              Trichormamide D 0
              Trichorovin-IIa 0
              Trichorovin-IVb 0
              Trichorovin-IXb 0
              Trichorovin-VIIa 0
              Trichorovin-Va 0
              Trichorovin-Vb 0
              Trichorovin-XI 0
              Trichorovin-XIIa 0
              Trichorovin-XIV 0
              Trichorozin-III 0
              Trichorzianine A IIIC 0
              Trichorzin HA-1 0
              Trichorzin HA-2 0
              Trichorzin HA-3 0
              Trichorzin HA-5 0
              Trichorzin HA-6 0
              Trichorzin HA-7 0
              Trichorzin MA-1 0
              Trichorzin MA-2 0
              Trichorzin MA-3 0
              Trichorzin PA IV 0
              Trichorzin PA IX 0
              Trichorzin PA V 0
              Trichorzin PA VI 0
              Trichorzin PA VII 0
              Trichorzin PA VIII 0
              Trichorzin PAu 4 0
              Trichovirin II 1a 0
              Trichovirin II 1b 0
              Trichovirin II 2a 0
              Trichovirin II 2b 0
              Trichovirin II 2c 0
              Trichovirin II 3a 0
              Trichovirin II 3b 0
              Trichovirin II 4a 0
              Trichovirin II 4b 0
              Trichovirin II 5 0
              Trichovirin II 6a 0
              Trichovirin II 6b 0
              Tridecaptin A1 0
              Tridecaptin M 0
              Trikoningin-KA-V 0
              Tychonamide B 0
              Tylopeptin A 0
              Tylopeptin B 0
              VSWKTWFPNLAV 0
              Vaby A 0
              Vaby B 0
              Vaby C 0
              Vaby D 0
              Vaby E 0
              Variochelin A 0
              Variochelin B 0
              Varv E 0
              Victoricine 0
              Victorinine B 0
              Victorinine D 0
              WHWLQLKPGQPMY 0
              YIIKGLFWDPAC + 0
              YIIKGVFWDPAC + 0
              YSPFHKWFPSMH 0
              abarelix 0
              afamelanotide 1
              albiglutide 0
              amoxicilloyl polylysine 0
              amyloid-beta + 0
              astressin 13
              astressin 2B 6
              bacitracin A + 45
              benzylpenicilloyl polylysine 0
              beta-endorphin 10
              bivalirudin 8
              calcitonin 2
              calcitonin (human synthetic) 0
              calcitonin (pork natural) 0
              calpastatin peptide Ac 184-210 0
              carperitide 0
              cathelicidin + 4
              corticorelin 0
              corticotropin 11
              corticotropin-releasing hormone + 1
              cosyntropin 1
              cyanophycin macromolecule + 0
              defensin + 0
              degarelix 0
              dermaseptin s3(1-16)-NH2 0
              desirudin 0
              elcatonin 0
              elf18 0
              enfuvirtide 3
              exendin-3 0
              exendin-4 0
              ganirelix 1
              gastrin + 7
              ghrelin 7
              insulin + 17
              kisspeptin-54 0
              koshikamide A2 0
              lantibiotic + 2
              lepirudin 1
              liraglutide 31
              lixisenatide 7
              mastoparans + 5
              melittin 105
              nesiritide 0
              nociceptin 1
              omega-conotoxin GVIA 7
              p-Glu-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe 0
              penicilloyl polylysine 0
              peptide YY 0
              poly(glycyl-L-arginine) 0
              pramlintide 0
              protein polypeptide chain + 26
              secretin human 0
              semaglutide 7
              sermorelin 0
              teduglutide 0
              teriparatide 0
              terlipressin 0
              tesamorelin 0
              thymalfasin 0
              tirzepatide 0
Path 2
Term Annotations click to browse term
  CHEBI ontology 19922
    subatomic particle 19892
      composite particle 19892
        hadron 19920
          baryon 19892
            nucleon 19920
              atomic nucleus 19892
                atom 19892
                  main group element atom 19866
                    p-block element atom 19866
                      carbon group element atom 19805
                        carbon atom 19802
                          organic molecular entity 19775
                            heteroorganic entity 19556
                              organochalcogen compound 19315
                                organooxygen compound 19205
                                  carbon oxoacid 18694
                                    carboxylic acid 18691
                                      carboacyl group 17723
                                        univalent carboacyl group 17723
                                          carbamoyl group 17576
                                            carboxamide 17576
                                              peptide 11440
                                                polypeptide 327
                                                  (12R)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                  (3S,6S,9S,12R,15S,18S,21S,24S,30S,33S)-30-ethyl-33-[(1R,2R)-1-hydroxy-2-methylhex-4-enyl]-1,4,7,10,12,15,19,25,28-nonamethyl-6,9,18,24-tetrakis(2-methylpropyl)-3,21-di(propan-2-yl)-1,4,7,10,13,16,19,22,25,28,31-undecazacyclotritriacontane-2,5,8,11,14,17,20,23,26,29,32-undecone 0
                                                  (4R)-4-[[(2S)-2-[[[2-(1-amino-2-methylbutyl)-4,5-dihydrothiazol-4-yl]-oxomethyl]amino]-4-methyl-1-oxopentyl]amino]-5-[[(2S,3S)-1-[[(3S,6R,9S,12R,15S,18R,21S)-3-(2-amino-2-oxoethyl)-18-(3-aminopropyl)-15-[(2S)-butan-2-yl]-6-(carboxymethyl)-9-(1H-imidazol-5-ylmethyl)-2,5,8,11,14,17,20-heptaoxo-12-(phenylmethyl)-1,4,7,10,13,16,19-heptazacyclopentacos-21-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-oxopentanoic acid 0
                                                  (6S)-N-[4-amino-1-[[1-[[4-amino-1-oxo-1-[[6,9,18-tris(2-aminoethyl)-3-(1-hydroxyethyl)-15-(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-12-propan-2-yl-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxobutan-2-yl]-6-methyloctanamide 0
                                                  2-[2-[2-[[2-[[2-[[2-[[2-[2-[[5-(diaminomethylideneamino)-2-[[2-methyl-2-[[3-methyl-2-[2-[[2-methyl-2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]butanoyl]amino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoylamino]propanoylamino]-2-methylpropanoic acid 0
                                                  2-[2-[[2-[[2-[[2-[[2-[2-[[5-(diaminomethylideneamino)-2-[[2-methyl-2-[[3-methyl-2-[2-[[2-methyl-2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]butanoyl]amino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoylamino]propanoic acid 0
                                                  2-[[2-[[2-[[2-[[2-[2-[[5-carbamimidamido-2-[[2-methyl-2-[2-[2-[[2-methyl-2-[2-[[4-methyl-2-[[2-methyl-2-[2-[2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[2-methyl-2-[[1-(2-methyl-3-oxotetradecanoyl)pyrrolidine-2-carbonyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoyl]amino]propanoylamino]propanoylamino]propanoyl]amino]pentanoyl]amino]propanoylamino]propanoyl]amino]propanoylamino]propanoylamino]propanoyl]amino]pentanoyl]amino]propanoylamino]-2-methylpropanoyl]amino]acetyl]amino]-2-methylpropanoyl]amino]-2-methylpropanoyl]amino]propanoic acid 0
                                                  Aborycin 0
                                                  Ac-Asp-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                  Ac-Asp-N(6)-(4-bromobenzoyl)-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-(5-chloropentanoyl)-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-(6-bromohexanoyl)-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-(chloroacetyl)-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-(octanoyl)-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[(2,2,2-trifluoroethoxy)acetyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[(2-iodophenyl)carbonyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[(2E)-3-(3-nitrophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[(2E)-3-(4-chlorophenyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[(2E)-3-(m-tolyl)prop-2-enoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[2,5-bis(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[2-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[3-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-[4-(trifluoromethyl)benzoyl]-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-\{(2E)-3-[2-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-\{(2E)-3-[3-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-\{(2E)-3-[4-(trifluoromethyl)phenyl]prop-2-enoyl\}-KATIGFEVQEE 0
                                                  Ac-Asp-N(6)-\{3-[2-(trifluoromethyl)phenyl]propanoyl\}-KATIGFEVQEE 0
                                                  Acidocin J-1132beta 0
                                                  Actagardine B 0
                                                  Actagardine, oxidised form 0
                                                  Actagardine, unoxidised form 0
                                                  Aibellin 0
                                                  Ampullosporin 77
                                                  Ampullosporin B 0
                                                  Ampullosporin C 0
                                                  Ampullosporin D 0
                                                  Ampullosporin E1 0
                                                  Ampullosporin E2 0
                                                  Ampullosporin E3 0
                                                  Ampullosporin E4 0
                                                  Amychelin B 0
                                                  Anafp 0
                                                  Andalusicin A 0
                                                  Arthrofactin 0
                                                  Atroviridin A 0
                                                  Atroviridin B 0
                                                  Atroviridin-Catr 0
                                                  Azotobactin delta 0
                                                  BI-32169 0
                                                  Bavaricin A 0
                                                  Bogorol A 0
                                                  Bonsecamin 0
                                                  Burrioplantin A 0
                                                  CIGB-300 0
                                                  Cacaoidin 0
                                                  Catenulipeptin 0
                                                  Cerexin B 0
                                                  Cerexin-D2 0
                                                  Cerexin-D3 0
                                                  Cerexin-D4 0
                                                  Cervinin 59-acetate 0
                                                  Chitinimide A 0
                                                  Chitinimide B 0
                                                  Chitinimide E 0
                                                  Chitinimide F 0
                                                  Chrysaibol 0
                                                  Chrysospermin A 0
                                                  Chrysospermin B 0
                                                  Chrysospermin C 0
                                                  Chrysospermin D 0
                                                  Cinnamomin 0
                                                  Cinnapeptin 0
                                                  Citrocin 0
                                                  Cittilin A 0
                                                  ComXRO-B-2 pheromone 0
                                                  Corbomycin 0
                                                  Curvopeptin-2 0
                                                  Curvopeptin-3 0
                                                  Curvopeptin-4 0
                                                  Curvopeptin-5 0
                                                  Curvopeptin-6 0
                                                  Cyanochelin A 0
                                                  Cypemycin 0
                                                  DASKALRSSGMP 0
                                                  DKATIGFEVQEE 0
                                                  DSGEGDFLAEGGGVR 0
                                                  Daspyromycin A 0
                                                  Daspyromycin B 0
                                                  Deacyl-GP1416 0
                                                  Deepginsen 0
                                                  Deoxyactagardine B 0
                                                  Divercin V41 0
                                                  ENPAVHFFKNIVTPRTP 0
                                                  ENPVVAFFKNIVTPRTP 0
                                                  ENPVVHFFFNIVTPRTP 0
                                                  ENPVVHFFKNIVTPRTP 0
                                                  ENPVVHFFYNIVTPRTP 0
                                                  Endopyrrole B 0
                                                  Enterocin CRL 35 0
                                                  Enterocin EJ97 0
                                                  Enterolysin A 0
                                                  FPAWFTKLYPRT 0
                                                  FR901451 0
                                                  Fabrubactin A 0
                                                  Fabrubactin B 0
                                                  Faulknamycin 0
                                                  Feglymycin 0
                                                  Felipeptin A1 0
                                                  Felipeptin A2 0
                                                  Fulvocin C 0
                                                  Fungal ferritin 0
                                                  Fusaoctaxin A 0
                                                  GP6738 0
                                                  Gabetaericin B1 0
                                                  Gabetaericin B3 0
                                                  Gallidermin 0
                                                  Glomerella cingulata peptide 0
                                                  Goadpeptin B 0
                                                  Goadvionin A1 0
                                                  Goadvionin A2 0
                                                  Goadvionin A3 0
                                                  Goadvionin A4 0
                                                  Goadvionin B1 0
                                                  Goadvionin B2 0
                                                  Goadvionin B3 0
                                                  Goadvionin B4 0
                                                  Gonadorelin hydrochloride 0
                                                  Grimoviridin 0
                                                  GsMTx4 0
                                                  Haereoplantin A 0
                                                  Haereoplantin B 0
                                                  Haereoplantin E 0
                                                  Halovir I 0
                                                  Halovir J 0
                                                  Halovir K 0
                                                  Harpin 0
                                                  Harzianin HC-6 0
                                                  Harzianin PCu 4 0
                                                  Heinamide B2 0
                                                  Heinamide B3 0
                                                  Holrhizin E 0
                                                  Holrhizin F 0
                                                  Holrhizin G 0
                                                  Holrhizin K 0
                                                  Holrhizin M 0
                                                  Holrhizin N 0
                                                  Holrhizin O 0
                                                  Holrhizin P 0
                                                  Holrhizin Q 0
                                                  Huascopeptin 0
                                                  Hypelcin B-I 0
                                                  Hypelcin B-II 0
                                                  Hypelcin B-III 0
                                                  Hypelcin B-IV 0
                                                  Hypelcin B-V 0
                                                  Hypomurocin A-3 0
                                                  Hypomurocin A-4 0
                                                  Hypomurocin A-5 0
                                                  Hypomurocin A-5a 0
                                                  Hypomurocin B-1 0
                                                  Hypomurocin B-2 0
                                                  Hypomurocin B-3a 0
                                                  Hypomurocin B-3b 0
                                                  Hypomurocin B-4 0
                                                  Hypomurocin B-5 0
                                                  IPQVWRDWFKLP 0
                                                  Iso-faulknamycin 0
                                                  JNK inhibitor I 0
                                                  KGKGKGKGKGENPAVHFFKNIVTPRTP 0
                                                  KGKGKGKGKGENPVVAFFKNIVTPRTP 0
                                                  KGKGKGKGKGENPVVHFFFNIVTPRTP 0
                                                  KGKGKGKGKGENPVVHFFKNIVTPRTP 0
                                                  KGKGKGKGKGENPVVHFFYNIVTPRTP 0
                                                  Kolobetain A 0
                                                  Kyamicin 0
                                                  LP237-F5 0
                                                  LP237-F7 0
                                                  LP237-F8 0
                                                  LSM-37009 0
                                                  LSM-37015 0
                                                  LSM-37045 0
                                                  LSM-37094 0
                                                  LSM-37129 0
                                                  LSM-37138 0
                                                  LSM-37175 0
                                                  LSM-37192 0
                                                  LSM-37213 0
                                                  Labetaomycin 0
                                                  Lacticin 481 0
                                                  Lactococcin mmfii 0
                                                  Lariatin A 0
                                                  Lariatin B 0
                                                  Laxaphycin B5 0
                                                  Laxaphycin B6 0
                                                  Leucinostatin NPDG A 0
                                                  Leucinostatin NPDG B 0
                                                  Leucocin B-TA33a 0
                                                  Leucocin C-TA33a 0
                                                  Ling Zhi-8 0
                                                  Linocin M18 0
                                                  Lyngbyazothrin A 0
                                                  Lyngbyazothrin B 0
                                                  Lyngbyazothrin C 0
                                                  Lyngbyazothrin D 0
                                                  Marinomonasin 0
                                                  Marinostatin 0
                                                  Michiganin A 0
                                                  Microcin J25 0
                                                  Microviridin C 0
                                                  Microviridin D 0
                                                  Microviridin E 0
                                                  Microviridin F 0
                                                  Microviridin H 0
                                                  Microviridin SD-1684 0
                                                  Mirabamide C 0
                                                  Mirabamide G 0
                                                  Mirabamide H 0
                                                  Misaugamycin A 0
                                                  Misaugamycin B 0
                                                  Myxarylin 0
                                                  N-Ac-Asp-N(6)-lipoyl-KATIGFEVQEE 0
                                                  N-[4-amino-1-[[1-[[4-amino-1-oxo-1-[[6,9,18-tris(2-aminoethyl)-3-(1-hydroxyethyl)-15-(2-methylpropyl)-2,5,8,11,14,17,20-heptaoxo-12-propan-2-yl-1,4,7,10,13,16,19-heptazacyclotricos-21-yl]amino]butan-2-yl]amino]-3-hydroxy-1-oxobutan-2-yl]amino]-1-oxobutan-2-yl]-6-methylheptanamide 0
                                                  N-acetyl-Asp-N(6)-[lipoyl]-Lys-Ala-Thr-Ile-Gly-Phe-Glu-Val-Gln-Glu-Glu 0
                                                  Neoatroviridin A 0
                                                  Neoatroviridin B 0
                                                  Neoatroviridin D 0
                                                  Neurokinin A 1
                                                  Neurokinin B 0
                                                  Nisin Z 0
                                                  Nocathioamide A 0
                                                  Nocathioamide B 0
                                                  Nocathioamide C 0
                                                  P-factor 0
                                                  PA48009 0
                                                  POH 1 0
                                                  POH 2 0
                                                  POH 3 0
                                                  Paenithopeptin A 0
                                                  Paenithopeptin B 0
                                                  Paenithopeptin C 0
                                                  Paenithopeptin D 0
                                                  Paenithopeptin E 0
                                                  Paracelsin E 0
                                                  Parasiticein 0
                                                  Pholipeptin 0
                                                  Piscicolin-61 0
                                                  Planosporicin 0
                                                  Plantaricin W 0
                                                  Plw-alpha 0
                                                  Polymyxin B1 Sulfate 0
                                                  Polymyxin B5 0
                                                  Polymyxin B6 0
                                                  Polymyxin E4 0
                                                  Polymyxin E7 0
                                                  Polymyxin Ile-E8 0
                                                  Polymyxin Nva-E1 0
                                                  Polymyxin Nva-E2 0
                                                  Polymyxin-P1 0
                                                  Polysporin A 0
                                                  Polysporin B 0
                                                  Polysporin C 0
                                                  Polysporin D 0
                                                  Polytheonamide A 0
                                                  Polytheonamide B 0
                                                  Potashchelin A 0
                                                  Potashchelin B 0
                                                  Potashchelin C 0
                                                  Potashchelin D 0
                                                  Pristinin A3 0
                                                  Propeptin 0
                                                  Propeptin-2 0
                                                  Prunipeptin 0
                                                  Pseudoalteropeptide A 0
                                                  Pseudodesmin C 0
                                                  Pseudovibriamide A1 0
                                                  Pseudovibriamide A3 0
                                                  Pseudovibriamide A5 0
                                                  Pseudovibriamide A6 0
                                                  QINTAKWWKTHF 0
                                                  QSPSYPDREYSDEDRQIKQMLHQECPRL-NH2 0
                                                  Quinoisobutyride A 0
                                                  RES-701-2 0
                                                  RES-701-3 0
                                                  RES-701-4 0
                                                  Rac1 Inhibitor W56 0
                                                  Rimomycin A 0
                                                  Rimomycin B 0
                                                  Rimomycin C 0
                                                  Ririwpeptide A 0
                                                  Ririwpeptide B 0
                                                  Rotihibin C 0
                                                  Rotihibin D 0
                                                  SN50 0
                                                  SPF-5506-A4 0
                                                  STAT3 inhibitor peptide 0
                                                  Sakacin 674 0
                                                  Salivaricin B 0
                                                  Salivaricin P 0
                                                  Scytocyclamide B 0
                                                  Scytocyclamide B2 0
                                                  Scytocyclamide B3 0
                                                  Scytocyclamide C 0